y PlantCAZyme

CAZyme Information

Basic Information
SpeciesRicinus communis
Cazyme ID30045.m000475
FamilyCBM20
Protein PropertiesLength: 901 Molecular Weight: 104161 Isoelectric Point: 6.2771
ChromosomeChromosome/Scaffold: 30045 Start: 194109 End: 212716
Descriptiondisproportionating enzyme 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20161043.1e-22
  VNLSFRIPYYTQWGQSLLVCGSKPILGSWNVKKGLLLSPVHEGEELIWYGTVSIPSAFSCEYSYYVVDDERNVLRWEMGKKRKLLLPEC
GH772008450
  IPMFSVRSENDLGVGEFLDLKLLVDWAVESGFHLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLTVHALSENLPEDVKREIQGAKERLDGKDVDYE
  ATLATKLSIAKQVFALEKDLILNSGSFQKYFSENEEWLKPYAAFCFLRDFFETSDHSQWGRFSQYSNEKLVKLVSKDSLHYEMICFHYYIQFHLHLQLSE
  AAEYARKKGVILKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNYAWWRARLTQMAKYFTAYRIDHILGFFRIWEL
  PEHAMTGLIGKFRPSIPLSQEELEKDGIWDFDRLSRPYIRQEFLQEKLGASWTFIAANFLNEHQKGRYEFKEDCNTEKKITSKLKTLAEKSMFESEDKIR
  HGLFDLLKNIVLIRDPEDARKFYPRFNLEDTSSFEDLDDHSKNVLKRLYYDYYFNRQENLWRKNAMKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELG
  LIGLRIQRMPSEPDLEFGIPSKYSYMTVCAPSCHDCSTFRAWWEEDEERRLRFFKIVVGSDILPPSQCTPDVACFIIRQHVEAPSMWAIFPLQDLLALKK
  EYMTRPATEETINDPTNPKHYWRYRVHVTLESLMKDKELKSTLKGL
Full Sequence
Protein Sequence     Length: 901     Download
MANLGLFSGT ESVKSVNLSF RIPYYTQWGQ SLLVCGSKPI LGSWNVKKGL LLSPVHEGEE    60
LIWYGTVSIP SAFSCEYSYY VVDDERNVLR WEMGKKRKLL LPECVNDGET AELHDLWQSG    120
GDAILFRSAF KDVIFRKSWN LNIERPLEVQ NKLEKEGTIS LETGQNRELS LDSSKVPPRH    180
IFLSDGMLRG MPWRGAGVAI PMFSVRSEND LGVGEFLDLK LLVDWAVESG FHLVQLLPIN    240
DTSVHGMWWD SYPYSSLSVF ALHPLYLTVH ALSENLPEDV KREIQGAKER LDGKDVDYEA    300
TLATKLSIAK QVFALEKDLI LNSGSFQKYF SENEEWLKPY AAFCFLRDFF ETSDHSQWGR    360
FSQYSNEKLV KLVSKDSLHY EMICFHYYIQ FHLHLQLSEA AEYARKKGVI LKGDLPIGVD    420
RNSVDTWVYP NLFRMNTSTG APPDYFDKNG QNWGFPTYNW EEMSKDNYAW WRARLTQMAK    480
YFTAYRIDHI LGFFRIWELP EHAMTGLIGK FRPSIPLSQE ELEKDGIWDF DRLSRPYIRQ    540
EFLQEKLGAS WTFIAANFLN EHQKGRYEFK EDCNTEKKIT SKLKTLAEKS MFESEDKIRH    600
GLFDLLKNIV LIRDPEDARK FYPRFNLEDT SSFEDLDDHS KNVLKRLYYD YYFNRQENLW    660
RKNAMKTLPV LLNSSDMLAC GEDLGLIPAC VHPVMQELGL IGLRIQRMPS EPDLEFGIPS    720
KYSYMTVCAP SCHDCSTFRA WWEEDEERRL RFFKIVVGSD ILPPSQCTPD VACFIIRQHV    780
EAPSMWAIFP LQDLLALKKE YMTRPATEET INDPTNPKHY WRYRVHVTLE SLMKDKELKS    840
TLKGLIHGSG RSYPSLGETD ERGKREPSVF ITGKQQVAGS EEKTVIAKQL SGALRKEASV    900
L                                                                    960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02950PLN029500.00072910275+
PLN02950PLN029507.0e-748159153+
pfam02446Glyco_hydro_775.0e-118200532335+
PLN02950PLN029500152842693+
PLN03236PLN032360178852703+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1tz7_B6e-2818951117329A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A6e-2818951117329A Chain A, Aquifex Aeolicus Amylomaltase
PDB2x1i_A8e-2822854838343A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
PDB1fp9_A9e-2622851138316A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1
Glyma0165s00200.1Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1
Glyma19g30580.1.16.102Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)