y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID325028
FamilyGT30
Protein PropertiesLength: 440 Molecular Weight: 48953.2 Isoelectric Point: 9.7834
ChromosomeChromosome/Scaffold: 6 Start: 1174648 End: 1176988
DescriptionKDO transferase A
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT30392180
  RWPERFGHPSAVRPPGSLVWFHAVSLGEGMAAIPVIRHCNERRPDLTILMTTTTVSAFEVIKDQLPVGVLHQFAPLDTPVAIDRFLGHWKPNAIIIMENE
  LWPNLIMAASGLLIPLAMLNARMSTKSFKRWSSPLLLPLVSLLLSKFSLIAPLSTLQGIHFQLLHAPPFVINYSGDLKYV
Full Sequence
Protein Sequence     Length: 440     Download
MKLGVFVYRL YRVLTYGVSP LINLHIRWRR LRGLEPCRRW PERFGHPSAV RPPGSLVWFH    60
AVSLGEGMAA IPVIRHCNER RPDLTILMTT TTVSAFEVIK DQLPVGVLHQ FAPLDTPVAI    120
DRFLGHWKPN AIIIMENELW PNLIMAASGL LIPLAMLNAR MSTKSFKRWS SPLLLPLVSL    180
LLSKFSLIAP LSTLQGIHFQ LLHAPPFVIN YSGDLKYVVN KFNASSGTSE SIRDLKVELS    240
EMKVWIASSL HRGEEEVILG VHNMLLESHP DSVVIIVPRH PHHGQQIAHK LRKDGQSVAL    300
RSQNEKLTSR KTNIYVVDTL GELRELYSVA PIAVIGGSFI PGLTGHNLSE AAAAGCAVIT    360
GCHVGHFSHM VKAMQQSNPL SVTQVSTKLE LKEAVDLLLS NPEILETQQR ASKEVYESLS    420
SCIITNIWNL LNLHIFRGK*                                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04413Glycos_transf_N2.0e-5638217182+
COG1519KdtA5.0e-1069416409+
PRK05749PRK057492.0e-1129415413+
Gene Ontology
GO TermDescription
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0016740transferase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2xcu_D5e-274243128371A Chain A, Structure Of The Bacteriophage T4 Tail Terminator Protein, Gp15 (c- Terminal Truncation Mutant 1-261).
PDB2xcu_C5e-274243128371A Chain A, Structure Of The Bacteriophage T4 Tail Terminator Protein, Gp15 (c- Terminal Truncation Mutant 1-261).
PDB2xcu_B5e-274243128371A Chain A, Structure Of The Bacteriophage T4 Tail Terminator Protein, Gp15 (c- Terminal Truncation Mutant 1-261).
PDB2xcu_A5e-274243128371A Chain A, Structure Of The Bacteriophage T4 Tail Terminator Protein, Gp15 (c- Terminal Truncation Mutant 1-261).
PDB2xci_D5e-274243128371A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis thalianaAT5G03770.1
Brachypodium distachyonBradi2g55417.1
Brassica rapaBra009511
Carica papayaevm.model.supercontig_5.99
Capsella rubellaCarubv10000940m
Chlamydomonas reinhardtiiCre13.g583100.t1.3
Citrus clementinaCiclev10032390mCiclev10032645m
Cucumis sativusCucsa.039090.1
Eucalyptus grandisEucgr.A01566.1
Fragaria vescamrna30104.1-v1.0-hybrid
Glycine maxGlyma10g07520.1
Gossypium raimondiiGorai.009G409200.3Gorai.009G409200.4Gorai.009G409200.2Gorai.009G409200.1
Linum usitatissimumLus10033622Lus10017663
Malus domesticaMDP0000133066
Manihot esculentacassava4.1_023442mcassava4.1_007754m
Medicago truncatulaMedtr1g061560.1
Mimulus guttatusmgv1a006467m
Oryza sativaLOC_Os01g63840.2LOC_Os01g63840.1
Panicum virgatumPavirv00040033mPavirv00069505m
Physcomitrella patensPp1s441_14V6.1
Phaseolus vulgarisPhvul.007G224100.1
Picea abiesMA_159008g0430
Populus trichocarpaPotri.016G095900.3Potri.016G095900.6Potri.016G095900.1Potri.016G095900.5Potri.016G095900.2
Potri.016G095900.4
Prunus persicappa025343m
Ricinus communis29815.m000507
Setaria italicaSi001596m
Selaginella moellendorffii76719
Sorghum bicolorSb03g040370.1
Thellungiella halophilaThhalv10013569m
Vitis viniferaGSVIVT01033751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny