y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID470376
FamilyAA3
Protein PropertiesLength: 761 Molecular Weight: 83994.7 Isoelectric Point: 8.6255
ChromosomeChromosome/Scaffold: 1 Start: 1255279 End: 1258138
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32367580
  EDRDSDTYKIECDAVVVGSGCGGGVAAAILAKSGLRVVVIEKGNYFVPRDYSALEGPSMFELFESNSLLMTHDGRFRFMAGSTVGGGSVVNWAASLKTPD
  AIIEEWSVHRGISVYSSEKYKAAMDRVLKRLGVTEKINSEGFQNRILRKGCEKLGLDVTIVPRNSTEKHNCGSCSFGCPTGEKRGTDSTWLVDAVNNNAV
  ILTQCKAEKLILADNNAHQREESGRRKRCLGVTASLSNRTRKKLQINAKVTIVACGSLKTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNSDFQGA
  AHEGEIVTSLHYVHPMEDSTTPNITLETPAIGPGTFAALAPWVSGPDMKERLAKYARTSHIFVMVRDEGVGEVKGDIVKYRLTKADEENLTTGLKQALRI
  LVAAGAAEVGTYRSDGQRMKCSGIKQEDVEAFLQAVNAPAGVVSMSKHWTQSFTAHQMGCCRMGATEKAGAIDGKGESWEAEDLYVCDASVLPTALGVNP
  MITVQSTAYCISNRIAELMKKKK
Full Sequence
Protein Sequence     Length: 761     Download
MVGGRRRLGK RGSPWLRWSA KQESFSHGFS QSDLQALSAI CDAIMPPVPL ESLNLEMKLK    60
VLRNDALLSF FKSSTSESHV RPDEVAELLA TKAIPLTVLV VRIVLRILTF RLGTLLLCGL    120
VCLDMKNWPF LLKFSEMSLE KREKVLQRWN TQWYNPLARI GFMMIKAIFL FYYFTWTNEN    180
TENPAWDAIN YRVEIGENEG MEQKERPLDQ GIIETAKEDE MTIKQRMINK GLKVTEDRDS    240
DTYKIECDAV VVGSGCGGGV AAAILAKSGL RVVVIEKGNY FVPRDYSALE GPSMFELFES    300
NSLLMTHDGR FRFMAGSTVG GGSVVNWAAS LKTPDAIIEE WSVHRGISVY SSEKYKAAMD    360
RVLKRLGVTE KINSEGFQNR ILRKGCEKLG LDVTIVPRNS TEKHNCGSCS FGCPTGEKRG    420
TDSTWLVDAV NNNAVILTQC KAEKLILADN NAHQREESGR RKRCLGVTAS LSNRTRKKLQ    480
INAKVTIVAC GSLKTPGLLA SSGLKNPNIG RGLHIHPILM AWGYFPERNS DFQGAAHEGE    540
IVTSLHYVHP MEDSTTPNIT LETPAIGPGT FAALAPWVSG PDMKERLAKY ARTSHIFVMV    600
RDEGVGEVKG DIVKYRLTKA DEENLTTGLK QALRILVAAG AAEVGTYRSD GQRMKCSGIK    660
QEDVEAFLQA VNAPAGVVSM SKHWTQSFTA HQMGCCRMGA TEKAGAIDGK GESWEAEDLY    720
VCDASVLPTA LGVNPMITVQ STAYCISNRI AELMKKKKKD *                        780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03970Rv06970.0007638754121+
pfam05199GMC_oxred_C1.0e-19613746134+
COG2303BetA5.0e-23265759556+
pfam00732GMC_oxred_N3.0e-88294518228+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD10696.1017601736Unknown protein [Arabidopsis thaliana]
GenBankACF22878.10257561718alcohol oxidase [Glycine max]
EMBLCAN71289.10147577738hypothetical protein [Vitis vinifera]
RefSeqNP_171895.2017601758alcohol oxidase-related [Arabidopsis thaliana]
RefSeqXP_002529832.10147569743electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3cox_A0.00000624974314494A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1coy_A0.00000624974314494A Chain A, Crystal Structure Of Cholesterol Oxidase Complexed With A Steroid Substrate. Implications For Fad Dependent Alcohol Oxidases
PDB3t37_A0.0000224372914499A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB2gew_A0.001682743433489A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB1n4w_A0.001682743433489A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7947536321267540
HO7792244502186650
EX2751362914597470
DC8838504772947610
HO8112163284297540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)