y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID491906
FamilyAA3
Protein PropertiesLength: 749 Molecular Weight: 81892.4 Isoelectric Point: 7.4156
ChromosomeChromosome/Scaffold: 7 Start: 5700342 End: 5703063
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32337398.26766e-44
  VHRIRCDAVVVGSGSGGGVAAANLAKAGFKVLVLEKGNYFAPQDYSGLEGPSMLELYEKSGLLTTVDGKFMLLAGSTVGGGTAVNWSASIRTPDHVLQEW
  SEGSKIKFFGSQEYQSAMDEVMTRIGVTERCVKDGFQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDRTWLVDAVENGAVILTGIK
  AERFVLVDNTSSSNERKKRCVGVIASSVGGKIGKKFIIEARMTASSAGSLLTPPLMLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIIT
  SVHHMNDAESGCRAILENPLIGPASYAGLSPWVSGADLKERMIKYGRTAHVFALVRDIGSGEVMKESEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEV
  GTYRSDGQRMKCEGITKEAMEEFLDEVDAVGGVSTKGEYWTTYFSAHQMGSCRMGATAEEGALDEIGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAY
  CISSKIV
Full Sequence
Protein Sequence     Length: 749     Download
MEEDRRRNRG HPLLRSMKRE DGYNHGFSPS QIQSLAVICQ TLLPPETTAE QQALNSFNVA    60
SSTQPPFTEE VAEMIVKNGR SEAVKVLKII LIILSFRFGT LLLCGSLCLD KSWPFVLKFS    120
QLPLDKREEI LRKWSRQSGF LLPFRITFFL AKFYTLFYFF SQTDENLKNP ALETIGYCLD    180
GIETSSNKKS EADKRRRPLE TGIIETTHES DVTITQSLIG KGVHVARDDG DNVHRIRCDA    240
VVVGSGSGGG VAAANLAKAG FKVLVLEKGN YFAPQDYSGL EGPSMLELYE KSGLLTTVDG    300
KFMLLAGSTV GGGTAVNWSA SIRTPDHVLQ EWSEGSKIKF FGSQEYQSAM DEVMTRIGVT    360
ERCVKDGFQN QVLRKGCERL GLQVESVPRN SPEDHYCGLC GYGCRAGAKN GTDRTWLVDA    420
VENGAVILTG IKAERFVLVD NTSSSNERKK RCVGVIASSV GGKIGKKFII EARMTASSAG    480
SLLTPPLMLS SGLKNPNIGR NLKLHPVLMT WGYFPEKDSE FSGKMYEGGI ITSVHHMNDA    540
ESGCRAILEN PLIGPASYAG LSPWVSGADL KERMIKYGRT AHVFALVRDI GSGEVMKESE    600
VTYRTTKKDR ENLRAGLRQA LRVSVAAGAV EVGTYRSDGQ RMKCEGITKE AMEEFLDEVD    660
AVGGVSTKGE YWTTYFSAHQ MGSCRMGATA EEGALDEIGE SWEAEGLFVC DGSVLPSAVG    720
VNPMITIQST AYCISSKIVD SLQSKRKV*                                      780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03970Rv06970.0007600727129+
pfam05199GMC_oxred_C3.0e-19600734135+
COG2303BetA3.0e-30256727540+
pfam00732GMC_oxred_N1.0e-90285507226+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK64154.1017481748unknown protein [Arabidopsis thaliana]
GenBankAAM63097.1017481748unknown [Arabidopsis thaliana]
GenBankACF22878.10237421716alcohol oxidase [Glycine max]
RefSeqNP_194586.1017481748alcohol oxidase-related [Arabidopsis thaliana]
RefSeqXP_002529832.10117438742electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3cox_A0.000000052297418504B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB1coy_A0.000000052297418504A Chain A, Crystal Structure Of Cholesterol Oxidase Complexed With A Steroid Substrate. Implications For Fad Dependent Alcohol Oxidases
PDB3nne_H0.0002427746226530A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.0002427746226530A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_F0.0002427746226530A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Transmembrane Domains
StartEnd
87109
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794753738117380
HO7792244502086570
EX2751362904487370
EG48125623912390
DK5531192245197420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)