y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G02145.1
FamilyGT22
Protein PropertiesLength: 494 Molecular Weight: 56803.8 Isoelectric Point: 9.4064
ChromosomeChromosome/Scaffold: 1 Start: 404600 End: 408619
DescriptionAlg9-like mannosyltransferase protein, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22203820
  LGSVAAIYVVMAPYTKVEESFNVQSMHDILYHRHHLDSYDHLEFPGVVPRTFIVSVFASPVVSIISCLGFPKVYSLVAARLVLGCIILSTLRFFRIQIKK
  KFGNQVETFFVLFTSLQFHFLFYCTRPLPNILALGLVNLAYGNWLKGNFYPALSFLIFATVIFRCDTMLLLGPIGLELLLTKSISFWKALKYCVGTALLA
  VGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLLGTLVDRRVPFFIVPVLSFVILYSKLPHKELRFIISSVPM
  FNLSAAVAASRIYNNRKKTIWKLVNMVMLAFFAISAGCTVVTFMASYYNYPSGYALKRLHQIG
Full Sequence
Protein Sequence     Length: 494     Download
MPTDSKMAKF LQSYGYDLIL GSVAAIYVVM APYTKVEESF NVQSMHDILY HRHHLDSYDH    60
LEFPGVVPRT FIVSVFASPV VSIISCLGFP KVYSLVAARL VLGCIILSTL RFFRIQIKKK    120
FGNQVETFFV LFTSLQFHFL FYCTRPLPNI LALGLVNLAY GNWLKGNFYP ALSFLIFATV    180
IFRCDTMLLL GPIGLELLLT KSISFWKALK YCVGTALLAV GLTIFVDSIM WKKFVWPEFE    240
VFWFNSILNR SSDWGTHSIH WYFTSALPRS LLVAYPLSLL GTLVDRRVPF FIVPVLSFVI    300
LYSKLPHKEL RFIISSVPMF NLSAAVAASR IYNNRKKTIW KLVNMVMLAF FAISAGCTVV    360
TFMASYYNYP SGYALKRLHQ IGHPANVAGE EWVHIDTFGA MNGISRFCED DFPWRYSKEE    420
EIVVEELRNR NFTYLVNEHS SVDGYKCLFY EEGFERLELR RGFPPIVLVK KAKVYLHREM    480
KKEDPFHKKW PGC*                                                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028163.0e-7218319102+
pfam03901Glyco_transf_222.0e-3732369356+
Gene Ontology
GO TermDescription
GO:0000009alpha-1,6-mannosyltransferase activity
GO:0006496protein amino acid terminal N-glycosylation
GO:0006506GPI anchor biosynthetic process
GO:0012505endomembrane system
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF59128.10454931449unknown protein [Arabidopsis thaliana]
RefSeqNP_001077446.1014931493transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.1014931497transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001117214.10454931453transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002526470.105480121602glycosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5466EC-2.4.1.258Dol-P-Man:Man5GlcNAc2-PP-Dol α-1,3-mannosyltransferase
Transmembrane Domains
StartEnd
1331
6688
95117
137159
171193
203225
288305
310332
345367
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG492307303863880
EG4646052762144890
EG4923962711183880
EL435541333373650
EG49239647861320.00000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma07g13150.1Glyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny