y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G10400.1
FamilyGT1
Protein PropertiesLength: 468 Molecular Weight: 52954.1 Isoelectric Point: 4.9809
ChromosomeChromosome/Scaffold: 1 Start: 3414852 End: 3416358
DescriptionUDP-glucoronosyl and UDP-glucosyl transferase domain containing protein, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12774402.2e-31
  DKGCNVLYVAFGSQAEISREQLEEIALGLEESKVNFLWVVKGNEIGKGFEERVGERGMMVRDEWVDQRKILEHESVRGFLSHCGWNSLTESICSEVPILA
  FPLAAEQPLNAILVVEELRVAERVVAASEGVVRREEIAEKVKELMEGEKGKELRRNVEAYGKMA
Full Sequence
Protein Sequence     Length: 468     Download
MELEKVHVVL FPYLSKGHMI PMLQLARLLL SHSFAGDISV TVFTTPLNRP FIVDSLSGTK    60
ATIVDVPFPD NVPEIPPGVE CTDKLPALSS SLFVPFTRAT KSMQADFERE LMSLPRVSFM    120
VSDGFLWWTQ ESARKLGFPR LVFFGMNCAS TVICDSVFQN QLLSNVKSET EPVSVPEFPW    180
IKVRKCDFVK DMFDPKTTTD PGFKLILDQV TSMNQSQGII FNTFDDLEPV FIDFYKRKRK    240
LKLWAVGPLC YVNNFLDDEV EEKVKPSWMK WLDEKRDKGC NVLYVAFGSQ AEISREQLEE    300
IALGLEESKV NFLWVVKGNE IGKGFEERVG ERGMMVRDEW VDQRKILEHE SVRGFLSHCG    360
WNSLTESICS EVPILAFPLA AEQPLNAILV VEELRVAERV VAASEGVVRR EEIAEKVKEL    420
MEGEKGKELR RNVEAYGKMA KKALEEGIGS SRKNLDNLIN EFCNNGT*                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02670PLN026709.0e-444389422+
PLN02448PLN024481.0e-577464484+
PLN02863PLN028636.0e-665389404+
PLN03007PLN030072.0e-681462495+
PLN02534PLN025342.0e-695461496+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0008194UDP-glycosyltransferase activity
GO:0012505endomembrane system
GO:0016757transferase activity, transferring glycosyl groups
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM62706.1074659470putative glucosyltransferase [Arabidopsis thaliana]
DDBJBAC41951.101034671365putative glucosyl transferase [Arabidopsis thaliana]
RefSeqNP_172511.3014671467UDP-glycosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_179281.3074659470UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana]
RefSeqNP_196990.2074658478transferase, transferring glycosyl groups [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A074558460A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2vch_A074558460A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2vce_A074558460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A054618476A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B3e-38846512464A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
2,4,6-trinitrotoluene degradationRXN-9743-UDP-glucose:2-hydroxylamino-4,6-dinitrotoluene-O-glucosyltransferase
2,4,6-trinitrotoluene degradationRXN-9745-UDP-glucose:2-amino-4,6-dinitrotoluene-glucosyltransferase
2,4,6-trinitrotoluene degradationRXN-9748-UDP-glucose:4-hydroxylamino-2,6-dinitrotoluene-O-glucosyltransferase
2,4,6-trinitrotoluene degradationRXN-9749-UDP-glucose:4-hydroxylamino-2,6-dinitrotoluene C-glucosyltransferase
2,4,6-trinitrotoluene degradationRXN-9751-UDP-glucose:4-amino-2,6-dinitrotoluene-glucosyltransferase
2,4,6-trinitrotoluene degradationRXN-9752-UDP-glucose:2-hydroxylamino-4,6-dinitrotoluene-C-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DK50036924512440
AU238093191262160
DY29272333473330
DY261794293963840
DY27612730373040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00292.1Aquca_025_00293.1Aquca_002_00206.1Aquca_004_00007.1Aquca_004_00008.1
Aquca_004_00009.1Aquca_031_00060.1
Arabidopsis lyrata480568874994350625471154
Arabidopsis thalianaAT2G16890.2AT5G14860.1
Brachypodium distachyonBradi2g36325.1Bradi2g36297.1Bradi4g28210.1Bradi1g43760.1Bradi1g37120.1
Bradi2g08147.1
Brassica rapaBra006271Bra008734Bra013043Bra018440
Capsella rubellaCarubv10013583mCarubv10003019mCarubv10013609mCarubv10016193mCarubv10012329m
Carubv10016195m
Citrus clementinaCiclev10015105m
Citrus sinensisorange1.1g019791morange1.1g048238m
Cucumis sativusCucsa.158560.1Cucsa.158600.1
Eucalyptus grandisEucgr.A01139.1Eucgr.J03156.1Eucgr.J03158.1Eucgr.J03155.1Eucgr.J03157.1
Eucgr.J03154.1
Fragaria vescamrna08733.1-v1.0-hybridmrna28389.1-v1.0-hybrid
Glycine maxGlyma16g08060.1
Gossypium raimondiiGorai.001G265200.1
Linum usitatissimumLus10022222Lus10022220Lus10022221Lus10026927Lus10026926
Lus10020124
Malus domesticaMDP0000575823MDP0000576836MDP0000159916MDP0000261158MDP0000296033
MDP0000800689MDP0000942526MDP0000691324MDP0000130487MDP0000203647
MDP0000865084
Manihot esculentacassava4.1_022533mcassava4.1_025192mcassava4.1_007045m
Mimulus guttatusmgv1a005626mmgv1a026899m
Oryza sativaLOC_Os06g39070.1LOC_Os09g16090.1LOC_Os09g16030.1LOC_Os09g21160.1LOC_Os04g24110.1
LOC_Os06g16000.1LOC_Os05g42040.1LOC_Os06g39080.1LOC_Os06g08830.1
Panicum virgatumPavirv00038352mPavirv00070294mPavirv00062203mPavirv00046074mPavirv00058520m
Pavirv00020575mPavirv00042658mPavirv00025139mPavirv00067592mPavirv00016340m
Pavirv00034420mPavirv00017568mPavirv00037090m
Physcomitrella patensPp1s15_417V6.2Pp1s15_417V6.1
Phaseolus vulgarisPhvul.007G048100.1Phvul.008G151900.1
Populus trichocarpaPotri.018G009000.1Potri.001G348100.1Potri.006G272600.1Potri.006G272500.2Potri.006G272500.1
Potri.018G008900.1Potri.005G036100.1
Prunus persicappa005107mppa023458mppa017646m
Ricinus communis29822.m00335529822.m003356
Setaria italicaSi033411mSi033010mSi006359mSi020900mSi006267m
Si006185m
Sorghum bicolorSb10g005950.1Sb02g022230.1Sb02g023640.1Sb02g023632.1Sb10g009810.1
Sb10g022980.1
Thellungiella halophilaThhalv10022679mThhalv10015356m
Vitis viniferaGSVIVT01016138001
Zea maysAC234524.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)