y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G17270.1
FamilyGT68
Protein PropertiesLength: 565 Molecular Weight: 63621.8 Isoelectric Point: 7.629
ChromosomeChromosome/Scaffold: 1 Start: 5909249 End: 5911693
DescriptionGDP-fucose protein-O-fucosyltransferase 2, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT682445400
  DRVLVIPSSKFDYQYDKVIDIERINTCLGRTVVISFDQFKEIDKKNNAHIDRFICYVSSPQPCYVDEDHIKKLKGLGVSIGGKLEAPWSEDIKKPTKRTS
  QEVVEKFKSDDGVIAIGDVFYADMEQDLVMQPGGPINHKCKTLIEPSRLILVTAQRFIQTFLGKNFISLHLRRHGFLKFCNAKSPSCFYPIPQAADCISR
  MVERANAPVIYLSTDAAESETGLLQSLVVVDGKVVPLVKRPPQNSAEKWDSLLYRHGIEDDSQVYAMLDKTICAMSSVFIGASGSTFTEDILRLRKD
Full Sequence
Protein Sequence     Length: 565     Download
MVRNSSDEEE DHRNLIPQND TRDNDLNLRP DARTVNMANG GGRSPRSALQ IDEILSRARN    60
RWKISVNKRY VVAAVSLTLF VGLLFLFTDT RTFFSSFKLD PMSSRVKESE LQALNLLRQQ    120
QLALVSLLNR TNFNSSNAIS SSVVIDNVKA ALLKQISVNK EIEEVLLSPH RTGNYSITAS    180
GSDSFTGSYN ADICRKVDQK LLDRKTIEWK PRPDKFLFAI CLSGQMSNHL ICLEKHMFFA    240
ALLDRVLVIP SSKFDYQYDK VIDIERINTC LGRTVVISFD QFKEIDKKNN AHIDRFICYV    300
SSPQPCYVDE DHIKKLKGLG VSIGGKLEAP WSEDIKKPTK RTSQEVVEKF KSDDGVIAIG    360
DVFYADMEQD LVMQPGGPIN HKCKTLIEPS RLILVTAQRF IQTFLGKNFI SLHLRRHGFL    420
KFCNAKSPSC FYPIPQAADC ISRMVERANA PVIYLSTDAA ESETGLLQSL VVVDGKVVPL    480
VKRPPQNSAE KWDSLLYRHG IEDDSQVYAM LDKTICAMSS VFIGASGSTF TEDILRLRKD    540
WGTSSMCDEY LCRGEEPNFI AENE*                                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.000521625035+
cd11548NodZ_like0.0001341539199+
cd11298O-FucT-29.0e-10405531127+
cd11296O-FucT_like1.0e-17380538169+
Gene Ontology
GO TermDescription
GO:0003674molecular_function
GO:0005575cellular_component
GO:0008150biological_process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD50008.1015641594AC007651_3 Hypothetical Protein [Arabidopsis thaliana]
GenBankAAM66093.1015641566unknown [Arabidopsis thaliana]
RefSeqNP_173170.2015641564unknown protein [Arabidopsis thaliana]
RefSeqNP_199853.1015641566unknown protein [Arabidopsis thaliana]
RefSeqXP_002264087.1015641559PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ap6_D0.003405531277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_C0.003405531277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_B0.003405531277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_A0.003405531277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap5_B0.004405531263369A Chain A, Crystal Structure Of Human Pofut2
Transmembrane Domains
StartEnd
6988
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX1285552972065020
ES8502683622045610
BX84086629912990
GO8818723562115630
CO0852392892605470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata918074889130474511
Arabidopsis thalianaAT5G50420.1AT1G53770.2AT1G53770.1
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1Eucgr.I02168.1
Fragaria vescamrna05486.1-v1.0-hybrid
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.006G090800.1Gorai.011G054400.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1Phvul.009G261000.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny