y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G24793.1
FamilyCE11
Protein PropertiesLength: 327 Molecular Weight: 35716.7 Isoelectric Point: 6.58
ChromosomeChromosome/Scaffold: 1 Start: 8767562 End: 8769438
DescriptionUDP-3-O- N-acetylglucosamine deacetylase, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE11393230
  QQTLAGSVEVKGKSLHSGKFSTVKLNPEIAGAGRFFEFRSRFIPASIEFAQESPLCTTLLKDELKIRTVEHLLSALEAKGVDNCRIQIESESSDDREVEV
  PIFDGSAKEWVDAIQGVGINAAQNHDGESVEKMVAHVNKPVYVCKNDTFVAAFPALETRITCGIDFPQVPAIGCQWFSWRPIHESSFAKDIASSRTFCVY
  EEVERMREAGLIKGGSLDNAIVCSAEHGWMNPPLRFDDEACRHKILDLIGDLSLVSRGGNGGLPVAHIVAYKAGHALHTDLARHL
Full Sequence
Protein Sequence     Length: 327     Download
MRLPVTVKAT KPSFLVIWIR YSSAASSPTV SLNPSGRLQQ TLAGSVEVKG KSLHSGKFST    60
VKLNPEIAGA GRFFEFRSRF IPASIEFAQE SPLCTTLLKD ELKIRTVEHL LSALEAKGVD    120
NCRIQIESES SDDREVEVPI FDGSAKEWVD AIQGVGINAA QNHDGESVEK MVAHVNKPVY    180
VCKNDTFVAA FPALETRITC GIDFPQVPAI GCQWFSWRPI HESSFAKDIA SSRTFCVYEE    240
VERMREAGLI KGGSLDNAIV CSAEHGWMNP PLRFDDEACR HKILDLIGDL SLVSRGGNGG    300
LPVAHIVAYK AGHALHTDLA RHLTMD*                                        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13188PRK131884.0e-6839323318+
TIGR00325lpxC4.0e-7239321289+
pfam03331LpxC1.0e-8539321289+
COG0774LpxC3.0e-8737323295+
PRK13186lpxC3.0e-10339323290+
Gene Ontology
GO TermDescription
GO:0008759UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG03128.101310239542AC004133_22 F5A9.8 [Arabidopsis thaliana]
GenBankAAG03130.101310239548AC004133_24 F5A9.4 [Arabidopsis thaliana]
DDBJBAD94001.1013261326hypothetical protein [Arabidopsis thaliana]
RefSeqNP_173874.2013261326UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
RefSeqNP_173884.50132644369UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4fw7_D8e-38393267280B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB4fw7_C8e-38393267280B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB4fw7_B8e-38393267280B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB4fw7_A8e-38393267280B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB4fw6_D8e-38393267280B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Metabolic Pathways
Pathway NameReactionECProtein Name
lipid IVA biosynthesisUDPACYLGLCNACDEACETYL-RXNEC-3.5.1.108UDP-3-O-acyl-N-acetylglucosamine deacetylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BX8379781561453000
BX83797812071260
FY44896724332400
CK277774273262980
CK277774253003240.22
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00088.3Aquca_091_00088.2Aquca_091_00088.1
Arabidopsis lyrata472870
Arabidopsis thalianaAT1G25054.1AT1G24793.2AT1G25210.2AT1G24880.1AT1G25054.2
AT1G25145.1AT1G25210.1
Brachypodium distachyonBradi1g69490.1
Brassica rapaBra010979
Carica papayaevm.model.supercontig_2.193
Capsella rubellaCarubv10009664m
Chlamydomonas reinhardtiiCre16.g653350.t1.2
Citrus clementinaCiclev10015996mCiclev10015964m
Citrus sinensisorange1.1g042138m
Cucumis sativusCucsa.188640.1Cucsa.188650.1
Eucalyptus grandisEucgr.B02675.2Eucgr.B02675.1
Glycine maxGlyma02g09350.1
Gossypium raimondiiGorai.002G172000.4Gorai.002G172000.5Gorai.002G172000.3Gorai.002G172000.1Gorai.002G172000.2
Gorai.002G172000.6Gorai.001G151600.1Gorai.010G050600.1Gorai.005G149500.1Gorai.005G145500.1
Gorai.009G391300.3Gorai.009G391300.2Gorai.009G391300.1Gorai.007G245600.1
Linum usitatissimumLus10003708Lus10001592
Malus domesticaMDP0000319902MDP0000264715MDP0000150490
Manihot esculentacassava4.1_012733m
Mimulus guttatusmgv1a025203m
Oryza sativaLOC_Os03g12320.3LOC_Os03g12320.2LOC_Os03g12320.1
Panicum virgatumPavirv00014435mPavirv00025226m
Physcomitrella patensPp1s1_376V6.1
Phaseolus vulgarisPhvul.003G019200.2Phvul.003G019200.1
Picea abiesMA_159099g0220MA_10433938g0010
Populus trichocarpaPotri.010G106400.1Potri.010G106400.2Potri.T177300.1Potri.010G106400.3
Prunus persicappa009014m
Ricinus communis29673.m000948
Setaria italicaSi036592mSi010565mSi036620m
Selaginella moellendorffii117127
Sorghum bicolorSb01g042410.1
Thellungiella halophilaThhalv10007963m
Vitis viniferaGSVIVT01011660001
Volvox carteriVocar20012425m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny