y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G30350.1
FamilyPL1
Protein PropertiesLength: 369 Molecular Weight: 40575.9 Isoelectric Point: 10.1446
ChromosomeChromosome/Scaffold: 1 Start: 10710079 End: 10711664
Descriptionpectate lyase precursor, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11062880
  FARDMVIVLKSQLMINSYKTIDGRGAKVEIANGPCLRIRQVKHVIIHGISIHDCKADPNGMDGDGIRVFQSTHVWIDHCFLSRCHDGLIDVIVSSTAVTI
  SNNYFTQHDKVMLLGHDDSYMGDKDMRVTIAFNTFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSANPIIFSEGNYFVA
Full Sequence
Protein Sequence     Length: 369     Download
MASLVVIVSL LLAAFASPLL ETAHSYNVTA PRVSLNPIDA CWRRNPKWAT NRQALAHCAV    60
GYGKAAIGGK NGPIYVVTNP SDNPTRPSPG TLRYAVSQPK PLWITFARDM VIVLKSQLMI    120
NSYKTIDGRG AKVEIANGPC LRIRQVKHVI IHGISIHDCK ADPNGMDGDG IRVFQSTHVW    180
IDHCFLSRCH DGLIDVIVSS TAVTISNNYF TQHDKVMLLG HDDSYMGDKD MRVTIAFNTF    240
GPGLIERMPR VRRGYAHVAN NRYEKWQMYA IGGSANPIIF SEGNYFVAPE KRSSKQVTKR    300
MMAGPDSKRW KWGTSRDVFM NGAFFGPPGV IVRPLYKGGE GFRVAHGSLV PSLTSSAGPL    360
 RCYVGRIC*                                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB1.0e-3168286239+
pfam00544Pec_lyase_C2.0e-61115286201+
smart00656Amb_all6.0e-84109289192+
Gene Ontology
GO TermDescription
GO:0008150biological_process
GO:0012505endomembrane system
GO:0016829lyase activity
GO:0030570pectate lyase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK28424.102136821368unknown [Arabidopsis thaliana]
RefSeqNP_172656.1013681384pectate lyase family protein [Arabidopsis thaliana]
RefSeqNP_174324.102136821368pectate lyase family protein [Arabidopsis thaliana]
Swiss-ProtO65388013681390PEL2_ARATH RecName: Full=Putative pectate lyase 2; Flags: Precursor
RefSeqXP_002518442.103536843390Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0363582343A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0363582343A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A9e-206428819248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A3e-18118286128330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pcl_A3e-1611529373283A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
Signal Peptide
Cleavage Site
16
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778688350363690
FG606120307363250
DT553691277423030
CO097456280363000
DK472540274362940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny