y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G43620.2
FamilyGT1
Protein PropertiesLength: 616 Molecular Weight: 68344.8 Isoelectric Point: 5.4702
ChromosomeChromosome/Scaffold: 1 Start: 16425412 End: 16430177
Descriptionsterol 3-beta-glucosyltransferase, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11635730
  VGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRSFVRAAGVEFYPLGGDPRELAAYMARNKGLIPSGPSEISKQRKQLKAIIESLLPACIEPDLETATSF
  RAQAIIANPPAYGHVHVAEALGVPIHIFFTMPWTPTNEFPHPLARVPQSAAYWLSYIVVDLMVWWSIRTYINDFRKRKLNLAPIAYFSTYHGSISHLPTG
  YMWSPHVVPKPSDWGPLVDVVGYCFLNLGSKYQPREEFLHWIERGSPPVYIGFGSMPLDDPKQTMDIILETLKDTEQRGIVDRGWGGLGNLATEVPENVF
  LVEDCPHDWLFPQCSAVVHHGGAGTTATGLKAGCPTTIVPFFGDQFFWGDRIYEKGLGPAPIPIAQLSVENLSSSIRFMLQPEVKSQVMELAKVLENEDG
  VAAAVDAFHRH
Full Sequence
Protein Sequence     Length: 616     Download
MASNVFDHPL QELEGEDNGV KSEKASLLET SGSVDTTPED SGHRSSDGHR GLDHCETAPV    60
GLYGDMLIND SEIQYSRSLT EKGSPAIHNL KLDRLSEQEK QKLIVELVRI QNDGTVEVID    120
NGTPVSELWE FEPTKGQSTI TYEKSLTESF RSIPRLKIAI LVVGTRGDVQ PFLAMAKRLQ    180
EFGHRVRLAT HANFRSFVRA AGVEFYPLGG DPRELAAYMA RNKGLIPSGP SEISKQRKQL    240
KAIIESLLPA CIEPDLETAT SFRAQAIIAN PPAYGHVHVA EALGVPIHIF FTMPWTPTNE    300
FPHPLARVPQ SAAYWLSYIV VDLMVWWSIR TYINDFRKRK LNLAPIAYFS TYHGSISHLP    360
TGYMWSPHVV PKPSDWGPLV DVVGYCFLNL GSKYQPREEF LHWIERGSPP VYIGFGSMPL    420
DDPKQTMDII LETLKDTEQR GIVDRGWGGL GNLATEVPEN VFLVEDCPHD WLFPQCSAVV    480
HHGGAGTTAT GLKAGCPTTI VPFFGDQFFW GDRIYEKGLG PAPIPIAQLS VENLSSSIRF    540
MLQPEVKSQV MELAKVLENE DGVAAAVDAF HRHLPPELPL PESSSEKKDE DDRPDLLQWF    600
FIQIGKKCCL PCGGV*                                                    660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01426MGT2.0e-9167568420+
COG1819COG18193.0e-37155572427+
pfam03033Glyco_transf_282.0e-38158302145+
cd03784GT1_Gtf_like2.0e-129157573417+
Gene Ontology
GO TermDescription
GO:0005773vacuole
GO:0005886plasma membrane
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0009813flavonoid biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18214.1050613136697unnamed protein product [Vitis vinifera]
RefSeqNP_175027.1016151615UDP-glucose:sterol glucosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002265312.1050613120681PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302172.1016121615predicted protein [Populus trichocarpa]
RefSeqXP_002524293.104861214577transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3h4t_A3e-291565661374A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB3h4i_A3e-291565661374A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products
PDB1iir_A2e-251565751403A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
PDB1rrv_B2e-231565571383A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1rrv_A2e-231565571383A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8014274381856150
DT5479143231744960
CO1037932761694440
GT1725503041374400
HO8014271911563457e-18
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00218.3Aquca_034_00218.2Aquca_034_00218.1Aquca_023_00154.1Aquca_034_00218.4
Aquca_023_00154.3Aquca_023_00154.2Aquca_114_00011.1Aquca_114_00011.2
Arabidopsis lyrata896855473768910517
Arabidopsis thalianaAT3G07020.2AT3G07020.1AT1G43620.3AT1G43620.1AT5G24750.1
Brachypodium distachyonBradi5g01230.1Bradi2g56102.1Bradi3g07997.4Bradi3g07997.3Bradi3g07997.2
Brassica rapaBra001229Bra040355Bra029615Bra020468
Carica papayaevm.model.supercontig_8.181evm.model.supercontig_21.209
Capsella rubellaCarubv10013188mCarubv10013187mCarubv10008593mCarubv10002561m
Chlamydomonas reinhardtiiCre07.g333450.t1.2
Citrus clementinaCiclev10020154mCiclev10011454mCiclev10000559mCiclev10000975m
Citrus sinensisorange1.1g013358morange1.1g006412morange1.1g008369morange1.1g013835morange1.1g047047m
Cucumis sativusCucsa.078450.1Cucsa.140330.2Cucsa.140330.1Cucsa.356970.2Cucsa.078450.2
Cucsa.363720.1
Eucalyptus grandisEucgr.H00810.1Eucgr.B01378.1Eucgr.F02699.1Eucgr.H01372.1Eucgr.B01630.1
Eucgr.F02699.2Eucgr.H01372.2Eucgr.G00612.3Eucgr.G00612.1Eucgr.G00612.2
Fragaria vescamrna16762.1-v1.0-hybridmrna17551.1-v1.0-hybridmrna08139.1-v1.0-hybrid
Glycine maxGlyma03g19751.1Glyma18g28130.2Glyma18g28130.1Glyma18g47490.2Glyma18g47490.1
Glyma02g08940.1Glyma10g36850.2Glyma20g30760.2Glyma20g30760.4Glyma20g30760.3
Glyma09g38830.2Glyma20g30760.6Glyma20g30760.5Glyma02g08940.2Glyma08g19700.2
Gossypium raimondiiGorai.001G184700.2Gorai.001G184700.10Gorai.001G184700.1Gorai.004G058300.2Gorai.004G058300.1
Gorai.004G261100.2Gorai.004G261100.1Gorai.009G254800.4Gorai.009G254800.3Gorai.009G254800.2
Gorai.009G254800.1Gorai.001G184700.3Gorai.009G254800.5Gorai.001G184700.4Gorai.001G184700.5
Gorai.001G184700.7Gorai.001G184700.6Gorai.001G184700.8Gorai.004G261100.3Gorai.008G041600.1
Linum usitatissimumLus10020382Lus10011882Lus10024544Lus10022815Lus10018878
Lus10009556Lus10028572Lus10011883Lus10020381Lus10009557
Malus domesticaMDP0000304346MDP0000278182MDP0000175609MDP0000304996MDP0000152076
MDP0000243097MDP0000771934MDP0000895000
Manihot esculentacassava4.1_004218mcassava4.1_003877mcassava4.1_025328mcassava4.1_014281m
Medicago truncatulaMedtr4g022580.1Medtr7g079430.1Medtr1g098640.2Medtr1g098640.1Medtr1g098640.3
Medtr4g022610.1
Mimulus guttatusmgv1a002910mmgv1a003019mmgv1a022288mmgv1a023756mmgv1a010079m
mgv1a004761mmgv1a005156m
Oryza sativaLOC_Os07g23740.3LOC_Os07g23740.2LOC_Os07g23740.1LOC_Os04g04254.2LOC_Os04g04254.1
LOC_Os01g64750.1LOC_Os04g04240.1LOC_Os02g11940.1
Panicum virgatumPavirv00030954mPavirv00043473mPavirv00043474mPavirv00048943mPavirv00056277m
Pavirv00034065mPavirv00051133m
Physcomitrella patensPp1s90_132V6.1Pp1s245_59V6.1Pp1s110_116V6.1Pp1s159_62V6.1Pp1s281_20V6.1
Pp1s131_65V6.1
Phaseolus vulgarisPhvul.008G056500.2Phvul.008G056500.1Phvul.010G013800.1Phvul.007G080800.1Phvul.004G093900.3
Phvul.004G093900.2Phvul.004G093900.1Phvul.006G212700.1
Picea abiesMA_84359g0010
Populus trichocarpaPotri.014G178300.1Potri.002G067100.1Potri.002G238600.4Potri.002G238600.2Potri.002G238600.1
Potri.002G067100.2Potri.005G193100.1Potri.002G238600.3Potri.003G021100.2Potri.003G021100.1
Prunus persicappa019814mppa002976mppa002535mppa005311m
Ricinus communis30204.m00179130128.m00900929863.m00104933210.m00003430116.m000381
Setaria italicaSi029583mSi009641mSi009639mSi017298m
Selaginella moellendorffii11051343056026840374515406232
Sorghum bicolorSb06g001270.1Sb03g040980.1Sb06g001270.2Sb02g010030.1Sb04g007366.1
Thellungiella halophilaThhalv10020288mThhalv10005442mThhalv10004004m
Vitis viniferaGSVIVT01028556001GSVIVT01034544001GSVIVT01019162001GSVIVT01023003001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)