y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G49640.1
FamilyCE10
Protein PropertiesLength: 316 Molecular Weight: 35428.9 Isoelectric Point: 5.9423
ChromosomeChromosome/Scaffold: 1 Start: 18375538 End: 18376729
Descriptiongibberellin receptor GID1L2, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10323130
  PTSLNPQNDVVSKDVMYSSDHNLSVRMFLPNKSRKLDTAGNKIPLLIYFHGGAYIIQSPFSPVYHNYLTEVVITANCLAVSVQYRLAPEHPVPAAYDDSW
  SAIQWIFSHSDDWINEYADFDRVFIAGDSAGANISHHMGIRAGKEKLSPTIKGIVMVHPGFWGKEPIDEHDVQDGEVRNKIAYIWENIVSPNSVDGVNDP
  WFNVVGSGSDVSEMGCEKVLVAVAGKDVFWRQGLAYAAKLEKSQWKGSVEVIEEEEEGHCFHLHNHNSQNASKLMQKFLEFI
Full Sequence
Protein Sequence     Length: 316     Download
MESDLTTEHH LPFIRIHKNG RVERLSGNDI KPTSLNPQND VVSKDVMYSS DHNLSVRMFL    60
PNKSRKLDTA GNKIPLLIYF HGGAYIIQSP FSPVYHNYLT EVVITANCLA VSVQYRLAPE    120
HPVPAAYDDS WSAIQWIFSH SDDWINEYAD FDRVFIAGDS AGANISHHMG IRAGKEKLSP    180
TIKGIVMVHP GFWGKEPIDE HDVQDGEVRN KIAYIWENIV SPNSVDGVND PWFNVVGSGS    240
DVSEMGCEKV LVAVAGKDVF WRQGLAYAAK LEKSQWKGSV EVIEEEEEGH CFHLHNHNSQ    300
NASKLMQKFL EFIIS*                                                    360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00135COesterase5.0e-666187141+
cd00312Esterase_lipase7.0e-766169114+
PRK10162PRK101626.0e-77716692+
COG0657Aes8.0e-2911294296+
pfam07859Abhydrolase_34.0e-5977294221+
Gene Ontology
GO TermDescription
GO:0005575cellular_component
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM61628.101231367372putative esterase [Arabidopsis thaliana]
GenBankAAT68324.1013151315hypothetical protein At1g49640 [Arabidopsis thaliana]
RefSeqNP_175387.1013151315hydrolase [Arabidopsis thaliana]
RefSeqNP_175389.1013141318AtCXE5 (Arabidopsis thaliana carboxyesterase 5); carboxylesterase
RefSeqNP_564550.101231367372cell death associated protein-related [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2o7v_A9.99995e-413219647208A Chain A, Crystal Structure Of (+)-Delta-Cadinene Synthase From Gossypium Arboreum And Evolutionary Divergence Of Metal Binding Motifs For Catalysis
PDB2o7r_A9.99995e-413219647208A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2zsi_A5e-313631065348A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2zsh_A5e-313631065348B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F1e-2570313108347B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Metabolic Pathways
Pathway NameReactionECProtein Name
formononetin biosynthesisRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
formononetin biosynthesisRXN-3625-2,7-dihydroxy-4'-methoxyisoflavanone dehydratase
isoflavonoid biosynthesis IRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IIRXN-3303EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IIRXN-5502-2,7,5-trihydroxy-4'-methoxyisoflavanone dehydratase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG41852519511950
EG4184902041133160
DK45859727112660
EG4184911991183160
EG4184851991183160
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00606.1.321.596Aquca_007_00606.1.321.596Aquca_015_00171.1Aquca_017_00080.1Aquca_015_00108.1
Aquca_015_00117.1Aquca_007_00602.1Aquca_028_00109.1Aquca_015_00115.1Aquca_054_00096.1
Aquca_007_00606.1.32.283Aquca_007_00606.1.32.283Aquca_007_00599.1Aquca_007_00607.1Aquca_007_00605.1
Aquca_007_00608.1
Arabidopsis lyrata485224484264473890891873891872
474099889348
Arabidopsis thalianaAT1G19190.1AT3G48700.1AT2G03550.1AT3G48690.1AT1G47480.1
AT1G49650.1AT1G49660.1
Brachypodium distachyonBradi4g32320.1Bradi4g32350.1Bradi3g38040.1Bradi4g32360.1Bradi1g45960.1
Bradi3g38045.1Bradi4g32080.1Bradi3g38080.1Bradi4g32310.1Bradi1g45930.1
Bradi4g32340.1Bradi1g45945.1Bradi3g38090.1Bradi1g45925.1Bradi4g32300.1
Bradi3g46460.1Bradi3g46450.1Bradi3g38060.1Bradi5g11800.1Bradi3g38050.1
Bradi4g32330.1Bradi1g74240.1Bradi3g38070.1
Brassica rapaBra019558Bra029912Bra029913Bra040667Bra014080
Bra016519Bra014213Bra018807Bra018808Bra018809
Bra025117Bra031068Bra025714
Carica papayaevm.model.supercontig_3272.2evm.model.supercontig_62.30evm.model.supercontig_62.31evm.TU.contig_24415.5evm.TU.contig_32334.1
evm.model.supercontig_2506.2evm.model.supercontig_2506.1evm.model.supercontig_1161.1evm.model.supercontig_62.32
Capsella rubellaCarubv10019264mCarubv10017570mCarubv10011237mCarubv10018816mCarubv10011932m
Carubv10009807mCarubv10011215m
Citrus sinensisorange1.1g021920morange1.1g039671morange1.1g021927morange1.1g043287morange1.1g042745m
orange1.1g022120morange1.1g020576morange1.1g043192morange1.1g019090morange1.1g046334m
orange1.1g018914morange1.1g042897morange1.1g047391morange1.1g046886morange1.1g045768m
orange1.1g036491morange1.1g036685morange1.1g036128morange1.1g042415m
Cucumis sativusCucsa.085230.1Cucsa.085220.1Cucsa.232690.1Cucsa.123550.1Cucsa.085210.1
Eucalyptus grandisEucgr.I01163.1Eucgr.L02920.1Eucgr.I01162.1Eucgr.G01495.1Eucgr.G01468.1
Eucgr.I01161.1Eucgr.G01469.1Eucgr.G01488.1Eucgr.G01474.1Eucgr.J02632.1
Eucgr.G01482.1Eucgr.G01481.1Eucgr.H03554.1Eucgr.J02629.1Eucgr.G01478.1
Eucgr.G01491.1Eucgr.H03555.1Eucgr.G01473.1Eucgr.F00244.1Eucgr.F00249.1
Eucgr.F00245.1Eucgr.F00251.1Eucgr.I01166.1Eucgr.F00250.1Eucgr.G01472.1
Eucgr.J02635.1Eucgr.F00248.1
Fragaria vescamrna28524.1-v1.0-hybrid.43.286mrna28524.1-v1.0-hybrid.43.286mrna28524.1-v1.0-hybrid.43.286mrna28526.1-v1.0-hybridmrna28525.1-v1.0-hybrid
mrna28521.1-v1.0-hybridmrna28508.1-v1.0-hybridmrna28530.1-v1.0-hybridmrna28520.1-v1.0-hybridmrna28611.1-v1.0-hybrid
mrna05895.1-v1.0-hybridmrna05894.1-v1.0-hybrid.369.649mrna05894.1-v1.0-hybrid.369.649mrna28615.1-v1.0-hybridmrna05894.1-v1.0-hybrid.44.323
mrna05894.1-v1.0-hybrid.44.323mrna28538.1-v1.0-hybridmrna05898.1-v1.0-hybrid.12.296mrna05898.1-v1.0-hybrid.12.296mrna17534.1-v1.0-hybrid
mrna05898.1-v1.0-hybrid.317.605mrna05898.1-v1.0-hybrid.317.605mrna09075.1-v1.0-hybridmrna28524.1-v1.0-hybrid.366.514mrna28524.1-v1.0-hybrid.366.514
mrna28524.1-v1.0-hybrid.366.514mrna09070.1-v1.0-hybridmrna28524.1-v1.0-hybrid.590.683mrna28524.1-v1.0-hybrid.590.683mrna28524.1-v1.0-hybrid.590.683
Glycine maxGlyma17g36220.1Glyma02g15160.1Glyma02g15150.1Glyma02g15120.1Glyma07g33330.1
Glyma10g39610.1Glyma01g45000.1Glyma01g44980.1Glyma20g28150.1Glyma01g45020.1
Glyma11g00650.1Glyma02g15170.1Glyma07g33320.1Glyma10g39600.1Glyma06g04140.1
Glyma04g03980.1Glyma02g15130.1Glyma07g33340.2
Gossypium raimondiiGorai.006G237000.1Gorai.009G210800.1Gorai.005G239400.1Gorai.005G103700.1Gorai.008G025200.1
Gorai.009G210700.1Gorai.005G239000.1Gorai.005G239200.1Gorai.005G239100.1Gorai.013G042500.1
Gorai.005G103600.1
Linum usitatissimumLus10027909Lus10012073Lus10019882Lus10014036Lus10021743
Lus10014033.130.379Lus10014033.130.379Lus10042662Lus10021745Lus10034068
Lus10019884Lus10014035Lus10019885Lus10014033.36.130Lus10014033.36.130
Malus domesticaMDP0000227827MDP0000554950MDP0000204521MDP0000167495MDP0000199442
MDP0000375330MDP0000939384MDP0000818542MDP0000569026MDP0000847523
MDP0000204319MDP0000164293MDP0000281635MDP0000143216MDP0000849027
MDP0000594621MDP0000431260MDP0000864575MDP0000173546MDP0000180763
MDP0000849585MDP0000794484MDP0000857937MDP0000269558MDP0000617328
MDP0000256478MDP0000198493MDP0000816142MDP0000413509
Manihot esculentacassava4.1_013627mcassava4.1_030588mcassava4.1_026915mcassava4.1_032921mcassava4.1_034056m
cassava4.1_013203mcassava4.1_011889mcassava4.1_011928mcassava4.1_029685mcassava4.1_025530m
cassava4.1_032193mcassava4.1_027531m
Medicago truncatulaMedtr4g086510.1Medtr4g086480.1Medtr4g086470.1Medtr5g005920.1Medtr4g086540.1
Medtr5g005850.1Medtr8g040860.1Medtr3g101420.1Medtr1g105020.1Medtr1g104930.1.37.322
Medtr1g104930.1.37.322Medtr7g051020.1Medtr5g005900.1Medtr1g104930.1.359.644Medtr1g104930.1.359.644
Mimulus guttatusmgv1a010621mmgv1a024424mmgv1a026137mmgv1a026120mmgv1a025384m
mgv1a027087mmgv1a018666mmgv1a027056mmgv1a009954m
Oryza sativaLOC_Os07g34280.1LOC_Os07g34240.1LOC_Os07g34170.1LOC_Os07g34370.1LOC_Os09g28620.1
LOC_Os06g11135.1LOC_Os08g37060.1LOC_Os09g28750.1LOC_Os06g11130.1LOC_Os09g28650.1
LOC_Os09g28720.1LOC_Os09g28690.1LOC_Os09g28630.1LOC_Os09g28640.1LOC_Os06g11090.1
LOC_Os09g28740.1LOC_Os08g37050.1LOC_Os09g28280.1LOC_Os08g37010.1LOC_Os09g28660.1
LOC_Os04g37680.1LOC_Os08g37040.1LOC_Os07g31790.1LOC_Os08g37030.1LOC_Os09g26500.1
LOC_Os02g53960.1LOC_Os02g35940.1LOC_Os09g28230.1LOC_Os09g26490.1LOC_Os09g28730.1
Panicum virgatumPavirv00010950mPavirv00059932mPavirv00059669mPavirv00048957mPavirv00036486m
Pavirv00041653mPavirv00066993mPavirv00022926mPavirv00031619mPavirv00001305m
Pavirv00008370mPavirv00034008mPavirv00015345mPavirv00043956mPavirv00021034m
Pavirv00016224mPavirv00011282mPavirv00018935mPavirv00057305mPavirv00028685m
Pavirv00051325mPavirv00025716mPavirv00047727mPavirv00004795mPavirv00063650m
Pavirv00013381mPavirv00042358mPavirv00005219mPavirv00021754mPavirv00044490m
Pavirv00028359mPavirv00001805mPavirv00053058mPavirv00017045mPavirv00060730m
Pavirv00015344mPavirv00035674mPavirv00070588mPavirv00011281mPavirv00060290m
Pavirv00010525mPavirv00039903mPavirv00036503mPavirv00017037mPavirv00064437m
Pavirv00033220mPavirv00057127mPavirv00011407mPavirv00044972mPavirv00014292m
Pavirv00028361mPavirv00041308mPavirv00003420mPavirv00039358mPavirv00066709m
Pavirv00041518mPavirv00020850mPavirv00055834mPavirv00003513mPavirv00064414m
Pavirv00048233mPavirv00066949mPavirv00067390mPavirv00028157mPavirv00054492m
Pavirv00002162mPavirv00041087mPavirv00048523mPavirv00051389mPavirv00048779m
Phaseolus vulgarisPhvul.003G295300.1Phvul.003G295200.1Phvul.003G295100.1Phvul.003G295000.1Phvul.007G054300.1
Phvul.002G047500.1Phvul.009G063600.1Phvul.007G054200.1Phvul.007G054400.1Phvul.001G020500.1
Picea abiesMA_384628g0010MA_10429351g0010MA_10374213g0010MA_10435734g0010MA_81147g0010
MA_893141g0010MA_7763304g0010MA_104449g0020MA_872227g0010MA_2054728g0010
MA_10189777g0010
Populus trichocarpaPotri.004G142800.1Potri.009G104600.1Potri.004G142900.1Potri.009G105100.1Potri.004G142400.1
Potri.009G104100.1Potri.009G104000.1Potri.009G104900.1Potri.009G104300.1Potri.009G103800.1
Potri.009G104400.1Potri.009G105000.1Potri.014G032700.1Potri.004G143200.1Potri.014G032800.1
Potri.014G032600.1Potri.009G104700.1Potri.004G143100.1Potri.004G143200.2Potri.009G104200.1
Potri.014G032500.1
Prunus persicappa009174mppa026088mppa021861mppa008902mppa021907m
ppb022581mppa009160mppa007279mppa027099mppa007658m
ppa008575mppa008552mppa008795mppa021622mppa020422m
ppa009150mppa022718mppa021391m
Ricinus communis29801.m00320929168.m00036829168.m00036929801.m00321029801.m003171
29206.m00014529801.m00320829801.m00321130005.m00125429844.m003358
30170.m01390729801.m00321230170.m01390830179.m000575
Setaria italicaSi006900mSi008230mSi013972mSi014057mSi030499m
Si010584mSi032884mSi030180mSi030599mSi006704m
Si030193mSi006872mSi030583mSi030333mSi008594m
Si030549mSi013922mSi008542mSi032135mSi036667m
Si026497mSi013984mSi030607mSi033100mSi015649m
Si015677mSi032992mSi015570mSi031952mSi006888m
Si030298mSi031940mSi014909mSi010617mSi008447m
Si025325m
Sorghum bicolorSb02g026800.1Sb02g001850.1Sb10g007228.1Sb02g026816.1Sb02g026790.2
Sb02g026790.1Sb08g017820.1Sb10g007224.1Sb10g007226.1Sb02g026550.1.339.632
Sb02g026550.1.339.632Sb02g026550.1.33.325Sb02g026550.1.33.325Sb04g023520.1Sb10g008950.1
Sb07g023110.1Sb07g023140.1Sb09g014531.1Sb07g023070.1
Thellungiella halophilaThhalv10010541mThhalv10011580mThhalv10004622mThhalv10011663mThhalv10012216m
Thhalv10012081m
Vitis viniferaGSVIVT01031776001GSVIVT01009528001GSVIVT01031770001GSVIVT01031772001GSVIVT01031769001
GSVIVT01031773001.521.663GSVIVT01031773001.521.663GSVIVT01031773001.233.348GSVIVT01031773001.233.348GSVIVT01031775001
GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01017924001
Zea maysAC218900.3_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)