y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT1G53770.1
FamilyGT68
Protein PropertiesLength: 564 Molecular Weight: 63942.9 Isoelectric Point: 7.864
ChromosomeChromosome/Scaffold: 1 Start: 20071313 End: 20073729
DescriptionGDP-fucose protein-O-fucosyltransferase 2, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT682395410
  KRVLVIPSHRFDYHYSRIIDIDRINTCLGRTVVVSFEEFWKKDKNRKKHHHVHINRFICYFSKPEPCYVDKEHITKLKALGITVGGKLDTPWEEDIARPS
  NKTAEEVEANFRSDDDVIAIGDVFYANVEREWVMQPGGPVAHKCRTLIEPNRLILLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKNPSCFFPIPQAAS
  CITRLIEKVEAPVLYLSTDAAESETGLLQSLLILNGKTVPLVKRPARDSAEKWDALLYRHGLEGDSQVEAMLDKTICALSSVFIGASGSTFTEDILRLRK
  DWG
Full Sequence
Protein Sequence     Length: 564     Download
MVKVSSSTTS SSSSSSPDEE SDLQNLLEES DSQIDQFRIS DEAAEQRPTF DVESLRSRLR    60
RSFKLNLTKK QSIFIFLPIV IILIYLSTDF SNYFSVKVPN SAFRSNTLTG RVHESDLQAL    120
YLLRKQESDL FSIWNHTVSN LSTIDDVKSA VFRQISLNRQ IQNALLSPHK TGNVDIGGSS    180
DGYFAGGSCR KVDQKLNGRK TIQWKPRPDK FLFAICLSGQ MSNHLICLEK HMFFAALLKR    240
VLVIPSHRFD YHYSRIIDID RINTCLGRTV VVSFEEFWKK DKNRKKHHHV HINRFICYFS    300
KPEPCYVDKE HITKLKALGI TVGGKLDTPW EEDIARPSNK TAEEVEANFR SDDDVIAIGD    360
VFYANVEREW VMQPGGPVAH KCRTLIEPNR LILLTAQRFI QTFLGKNYIA LHFRRHGFLK    420
FCNAKNPSCF FPIPQAASCI TRLIEKVEAP VLYLSTDAAE SETGLLQSLL ILNGKTVPLV    480
KRPARDSAEK WDALLYRHGL EGDSQVEAML DKTICALSSV FIGASGSTFT EDILRLRKDW    540
GTASECDEYL CANEQPNFIA DHE*                                           600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.000521125242+
pfam10250O-FucT0.0002234530325+
cd11298O-FucT-23.0e-8404530127+
cd11296O-FucT_like1.0e-17378537170+
Gene Ontology
GO TermDescription
GO:0003674molecular_function
GO:0005886plasma membrane
GO:0008150biological_process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF00786.1015631563hypothetical protein [Arabidopsis thaliana]
RefSeqNP_173170.20155634564unknown protein [Arabidopsis thaliana]
RefSeqNP_175780.1015631563unknown protein [Arabidopsis thaliana]
RefSeqNP_199853.10155634566unknown protein [Arabidopsis thaliana]
RefSeqXP_002264087.10165635559PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ap6_D0.009404530277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_C0.009404530277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_B0.009404530277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_A0.009404530277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap5_B0.01404530263369A Chain A, Crystal Structure Of Human Pofut2
Transmembrane Domains
StartEnd
7294
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8818723602065620
ES8502683461985410
EX1285553012015010
CO0852392932555460
FQ3169042782715480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata918074889130474511
Arabidopsis thalianaAT5G50420.1AT1G17270.1AT1G53770.2
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1Eucgr.I02168.1
Fragaria vescamrna05486.1-v1.0-hybrid
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.006G090800.1Gorai.011G054400.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1Phvul.009G261000.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny