y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT3G05320.1
FamilyGT65
Protein PropertiesLength: 446 Molecular Weight: 50648.5 Isoelectric Point: 9.5057
ChromosomeChromosome/Scaffold: 3 Start: 1513450 End: 1514895
Descriptionprotein-O-fucosyltransferase 1, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65783880
  GLNNQKIAFARACLTARMMNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQFERFNSLCSGFVRLSRFSDVKNRAQVFDLEKGSGRRWTVERDLEHLKQSA
  RNESIDEFEVIRLIGKNPFLWHDHWPVEDYAKVFECMVVVDEISREADKVVMKIREAGEAERAKLASKTEILGPVPFVAVHMRIEIDWMIHCKKLEQRKK
  ISEICSSKREILDRVGNISGLKTPTVLYLAVADTLLEEKEEDSSVLSGWRDGLIPFEKKKLGVKEEIYGKYSYLIQSAIDYEVCLRADVFVGNSFSTFSS
  LIVLERTQKAR
Full Sequence
Protein Sequence     Length: 446     Download
MNSPLSSKNL RIFSKSVACK CLVLVGIALF YRALLLSYSP RNALSNSLLF RDRHMSDSSS    60
TGGIRTDKFL EVPQIVWGLN NQKIAFARAC LTARMMNRTL LMPSLSASLF YKEVDKLRPI    120
PFDKVFQFER FNSLCSGFVR LSRFSDVKNR AQVFDLEKGS GRRWTVERDL EHLKQSARNE    180
SIDEFEVIRL IGKNPFLWHD HWPVEDYAKV FECMVVVDEI SREADKVVMK IREAGEAERA    240
KLASKTEILG PVPFVAVHMR IEIDWMIHCK KLEQRKKISE ICSSKREILD RVGNISGLKT    300
PTVLYLAVAD TLLEEKEEDS SVLSGWRDGL IPFEKKKLGV KEEIYGKYSY LIQSAIDYEV    360
CLRADVFVGN SFSTFSSLIV LERTQKARRL GFMSSCKDGG NKWRSYAYNL AGESNGVPRR    420
WMTNMTHSSL QAISYGSNSV SCSSG*                                         480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11302O-FucT-10.003218388193+
cd11296O-FucT_like0.00026911749+
cd11299O-FucT_plant2.0e-1478384335+
cd11296O-FucT_like1.0e-22200384190+
pfam10250O-FucT1.0e-5178388342+
Gene Ontology
GO TermDescription
GO:0003674molecular_function
GO:0005575cellular_component
GO:0008150biological_process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN72045.10954451351unknown protein [Arabidopsis thaliana]
RefSeqNP_187183.3014451445unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10174421427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002332132.10954421347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.106044265446conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.0001253388212349A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB3zy5_A0.0001253388212349A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB3zy4_A0.0001253388212349A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB3zy3_B0.0001253388212349A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB3zy3_A0.0001253388212349A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX7768972421934330
EE465432254102620
FD5479482162194330
DW5174702611824330
DW5173972541824260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny