y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT3G15940.1
FamilyGT4
Protein PropertiesLength: 698 Molecular Weight: 78706.8 Isoelectric Point: 10.7714
ChromosomeChromosome/Scaffold: 3 Start: 5393513 End: 5396759
Descriptionglycosyl transferase, group 1 domain containing protein, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45366634.2e-22
  QKQDLKLLLGSVGSKSNKVAYVKEMLSFLSNNGNLSNSVLWTPATTRVASLYSAADVYVTNSQGVGETFGRVTIEAMAYGLPVLGTDAGGTKEIVEHNVT
  GLLHPVGRAGNKVLAQNLLFLLRNPSTR
Full Sequence
Protein Sequence     Length: 698     Download
MEDLRLSPLK LGSFKSSLSG RSTPRGSPTL RKVHSGRTPR REGKGSGGAV QWFRSNRLLY    60
WLLLITLWTY LGFYVQSRWA HDDDNKVEFL RFGGKLREDV LHVEQNKRRD LVADESSHAV    120
VDHTNIVHLG VNKRMHVTLA KKEDSTSRRS VSPRRRTRKA SRSSRTRIRS TQKVRKVMET    180
KELDEQDQEL PNINVTYGKL FGPFGSLEDR ILEWSPQKRS GTCDRKSDFK RLVWSRRFVL    240
LFHELSMTGA PISMMELASE LLSCGATVYA VVLSRRGGLL QELTRRRIKV VEDKGELSFK    300
TAMKADLVIA GSAVCASWID QYMDHHPAGG SQIAWWVMEN RREYFDRAKP VLDRVKLLIF    360
LSEVQSKQWL TWCEEDHVKL RSQPVIVPLS VNDELAFVAG VSSSLNTPTL TQETMKEKRQ    420
KLRESVRTEF GLTDKDMLVM SLSSINPGKG QLLLLESVAL ALEREQTQEQ VAKRNQSKII    480
KNLNGIRKEK ISLSARHRLR GSSRKMKITS PAVDNHPSVL SATGRRKLLL SGNVTQKQDL    540
KLLLGSVGSK SNKVAYVKEM LSFLSNNGNL SNSVLWTPAT TRVASLYSAA DVYVTNSQGV    600
GETFGRVTIE AMAYGLPVLG TDAGGTKEIV EHNVTGLLHP VGRAGNKVLA QNLLFLLRNP    660
STRLQLGSQG REIVEKMYMK QHMYKRFVDV LVKCMRP*                            720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03798GT1_wlbH_like6.0e-18582694113+
cd03825GT1_wcfI_like4.0e-1958167898+
TIGR00009L282.0e-19583696114+
cd03808GT1_cap1E_like6.0e-23576689114+
cd03801GT1_YqgM_like9.0e-25583691109+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
GO:0009507chloroplast
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_175651.1016971670glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqNP_188215.1016971697glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002284822.1016961689PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298139.101269624679predicted protein [Populus trichocarpa]
RefSeqXP_002528176.10469615684glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.000000005564696259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.000000005564696259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.000000005564696259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.000000005564696259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.000000005564696259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
5880
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FD9875462372154510
FG1474092581944510
HS0643982421784190
EY8095232441984410
GW8335872322114420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT1G52420.1
Brachypodium distachyonBradi2g09620.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybridmrna05979.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma06g03220.1Glyma15g01640.6Glyma15g01640.5Glyma15g01640.4
Glyma15g01640.3Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1Gorai.011G077500.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.2Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01009775001GSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)