y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT3G19280.1
FamilyGT10
Protein PropertiesLength: 502 Molecular Weight: 56205.2 Isoelectric Point: 8.3975
ChromosomeChromosome/Scaffold: 3 Start: 6681196 End: 6683892
Descriptionglycoprotein 3-alpha-L-fucosyltransferase A, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101393770
  DAAFGLSHQPGTLSIIRSMESAQYYQENNLAQARRKGYDIVMTTSLSSDVPVGYFSWAEYDIMAPVQPKTEKALAAAFISNCAARNFRLQALEALMKTNV
  KIDSYGGCHRNRDGSVEKVEALKHYKFSLAFENTNEEDYVTEKFFQSLVAGSVPVVVGAPNIEEFAPSPDSFLHIKQMDDVKAVAKKMKYLADNPDAYNQ
  TLRWKHEGPSDSFKALIDMAAVHSSCRLCIFVATRIREQ
Full Sequence
Protein Sequence     Length: 502     Download
MGVFSNLRGP KIGLTHEELP VVANGSTSSS SSPSSFKRKV STFLPICVAL VVIIEIGFLC    60
RLDNASLVDT LTHFFTKSSS DLKVGSGIEK CQEWLERVDS VTYSRDFTKD PIFISGSNKD    120
FKSCSVDCVM GFTSDKKPDA AFGLSHQPGT LSIIRSMESA QYYQENNLAQ ARRKGYDIVM    180
TTSLSSDVPV GYFSWAEYDI MAPVQPKTEK ALAAAFISNC AARNFRLQAL EALMKTNVKI    240
DSYGGCHRNR DGSVEKVEAL KHYKFSLAFE NTNEEDYVTE KFFQSLVAGS VPVVVGAPNI    300
EEFAPSPDSF LHIKQMDDVK AVAKKMKYLA DNPDAYNQTL RWKHEGPSDS FKALIDMAAV    360
HSSCRLCIFV ATRIREQEEK SPEFKRRPCK CTRGSETVYH LYVRERGRFD MESIFLKDGN    420
LTLEALESAV LAKFMSLRYE PIWKKERPAS LRGDGKLRVH GIYPIGLTQR QALYNFKFEG    480
NSSLSTHIQR NPCPKFEVVF V*                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_105.0e-30180367195+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0006487protein N-linked glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM77473.10865011416core alpha 1,3-fucosyltransferase [Arabidopsis thaliana]
GenBankAAO64480.1015011513core alpha 1, 3-fucosyltransferase [Arabidopsis thaliana]
GenBankAAQ83526.1015011501alpha 1,3 fucosyltransferase [Arabidopsis thaliana]
RefSeqNP_175393.1015011513FUT12 (FUCOSYLTRANSFERASE 12); fucosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_188559.1015011501FUT11 (FUCOSYLTRANSFERASE 11); 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase/ fucosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.0000004214350183315A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB2nzy_B0.0000004214350183315A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB2nzy_A0.0000004214350183315A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB2nzx_C0.0000004214350183315A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB2nzx_B0.0000004214350183315A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK1204862621333940
DT7327912821944750
CO0767162631444060
EH7361072581373940
EH7731832582004570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT1G49710.1
Brachypodium distachyonBradi3g38160.2Bradi3g38160.1
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Fragaria vescamrna28254.1-v1.0-hybrid
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.013G044300.2Gorai.002G008200.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Phaseolus vulgarisPhvul.003G292000.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Prunus persicappa004581m
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Sorghum bicolorSb07g022980.1
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny