y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT3G53950.1
FamilyAA5
Protein PropertiesLength: 546 Molecular Weight: 60004.4 Isoelectric Point: 5.3125
ChromosomeChromosome/Scaffold: 3 Start: 19975619 End: 19977439
Descriptionglyoxal oxidase-related, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA5315430
  DLPGSWELIVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALDRHRCRRDPKDAALKRDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQT
  GGDKDGFKKIRKFEPCDPNETCDWVELQDTELITGRWYASNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLADVEDKQMDNLYPYVHLLPDDDGG
  NLFIFANSRAVKYDHRINAVVKEYPPLDGGPRNYPSGGSSAMLAIQGDFTTAEILICGGAQSGAFTARAIDAPAHGTCGRIVATAADPVWVTEEMPFGRI
  MGDMVNLPTGEILIINGAQAGSQGFEMGSDPCLYPLLYRPDQPIGLRFMTLNPGTVPRMYHSTANLLPDGRILLAGSNPHYFYKFNAEFPTELRIEAFSP
  EYLSPDRANLRPEIQEIPQIIRYGEVFDVFVTVPLPVVGIIQMNWGSAPFATHSFSQGQRLVKLTVAPSVPDGVGRYRIQCTAPPNGAVSPPGYYMAFAV
  NQGVPSIARWIRI
Full Sequence
Protein Sequence     Length: 546     Download
MAELIPWYYT SGSGIVLVLQ TIFLFSIVRA DLPGSWELIV QDAGIASMHT AVTRFNTVIL    60
LDRTNIGPSR KALDRHRCRR DPKDAALKRD CYAHSVLFDL GTNQIRPLMI QTDTWCSSGQ    120
FLSDGSLLQT GGDKDGFKKI RKFEPCDPNE TCDWVELQDT ELITGRWYAS NQILPDGSVI    180
IVGGRGTNTV EYYPPRENGA VPFQFLADVE DKQMDNLYPY VHLLPDDDGG NLFIFANSRA    240
VKYDHRINAV VKEYPPLDGG PRNYPSGGSS AMLAIQGDFT TAEILICGGA QSGAFTARAI    300
DAPAHGTCGR IVATAADPVW VTEEMPFGRI MGDMVNLPTG EILIINGAQA GSQGFEMGSD    360
PCLYPLLYRP DQPIGLRFMT LNPGTVPRMY HSTANLLPDG RILLAGSNPH YFYKFNAEFP    420
TELRIEAFSP EYLSPDRANL RPEIQEIPQI IRYGEVFDVF VTVPLPVVGI IQMNWGSAPF    480
ATHSFSQGQR LVKLTVAPSV PDGVGRYRIQ CTAPPNGAVS PPGYYMAFAV NQGVPSIARW    540
IRIVS*                                                               600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam09118DUF19291.0e-30441543104+
cd02851E_set_GO_C1.0e-34438543107+
pfam07250Glyoxal_oxid_N2.0e-13848289247+
Gene Ontology
GO TermDescription
GO:0003674molecular_function
GO:0008150biological_process
GO:0012505endomembrane system
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA42922.10275448522glyoxal oxidase [Vitis pseudoreticulata]
GenBankACV49899.10275448522glyoxal oxidase [Vitis vinifera]
RefSeqNP_190963.1015451545glyoxal oxidase-related [Arabidopsis thaliana]
RefSeqXP_002274763.102154413541PREDICTED: similar to glyoxal oxidase [Vitis vinifera]
RefSeqXP_002322929.10165453528predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2eid_A1e-17109544221638A Chain A, Galactose Oxidase W290g Mutant
PDB2wq8_A4e-17109544243660A Chain A, Glycan Labelling Using Engineered Variants Of Galactose Oxidase Obtained By Directed Evolution
PDB2eib_A8e-17109544221638A Chain A, Crystal Structure Of Galactose Oxidase, W290h Mutant
PDB2vz3_A9e-17109544221638A Chain A, Crystal Structure Of Galactose Oxidase, W290h Mutant
PDB2vz1_A9e-17109544221638A Chain A, Crystal Structure Of Galactose Oxidase, W290h Mutant
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DK535148285313150
DY292873347283730
DY303362359363920
DK47554426212620
BX83545024512450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00849.1Aquca_002_00488.1Aquca_011_00031.1Aquca_006_00149.1Aquca_001_00162.1
Aquca_001_00162.2Aquca_011_00437.1Aquca_003_00264.1Aquca_020_00284.2Aquca_020_00284.1
Arabidopsis lyrata485786907231895435472215888820
475824488852
Arabidopsis thalianaAT3G57620.1AT1G75620.1AT1G14430.1AT1G19900.1AT5G19580.1
AT1G67290.1
Brachypodium distachyonBradi1g67590.1Bradi2g46477.1Bradi4g24270.1Bradi2g16900.1
Brassica rapaBra021337Bra003160Bra026220Bra026831Bra012193
Bra016489Bra025780Bra012194Bra015830Bra008211
Bra020050Bra034008Bra004215Bra002247
Carica papayaevm.model.supercontig_56.57evm.model.supercontig_140.32evm.model.supercontig_140.31evm.model.supercontig_34.155evm.model.supercontig_4.17
evm.model.supercontig_23.56
Capsella rubellaCarubv10016978mCarubv10019204mCarubv10012343mCarubv10021300mCarubv10011386m
Carubv10022352mCarubv10000533m
Chlamydomonas reinhardtiiCre17.g732350.t2.1Cre17.g732350.t1.3Cre06.g306000.t1.3g6393.t1g11468.t1
Cre16.g657200.t1.1g11469.t1Cre16.g657250.t1.2Cre05.g243450.t2.1Cre05.g243450.t1.3
g11470.t2g11470.t1Cre03.g152050.t1.2Cre16.g693950.t1.3g3003.t1
g3001.t1Cre16.g677300.t1.3g3002.t1Cre13.g577300.t1.2Cre17.g732600.t1.2
Cre09.g396451.t1.3g14185.t1
Citrus clementinaCiclev10011448mCiclev10031195mCiclev10000768mCiclev10024435mCiclev10003275m
Ciclev10010756mCiclev10010177mCiclev10006853mCiclev10033514mCiclev10007862m
Citrus sinensisorange1.1g044265morange1.1g041651morange1.1g048017morange1.1g009420morange1.1g043369m
orange1.1g035640morange1.1g039705morange1.1g042303morange1.1g048136morange1.1g042680m
Cucumis sativusCucsa.175840.1Cucsa.342810.1Cucsa.196370.1Cucsa.159730.1Cucsa.342800.1
Cucsa.116480.1
Eucalyptus grandisEucgr.B02726.1Eucgr.F01844.1Eucgr.B01735.1Eucgr.G02553.1Eucgr.B00180.1
Eucgr.C03801.1
Fragaria vescamrna11865.1-v1.0-hybrid
Glycine maxGlyma01g25830.1Glyma03g17300.1Glyma02g02610.1Glyma19g43050.1Glyma03g40410.1
Glyma04g02880.1Glyma14g40600.1Glyma06g02900.1Glyma06g02890.1Glyma06g18490.1
Glyma01g34760.1Glyma08g04030.1Glyma09g32620.2
Gossypium raimondiiGorai.006G169500.1Gorai.009G270800.1Gorai.007G286100.1Gorai.008G183000.1Gorai.006G263100.1
Gorai.006G263000.1Gorai.009G196400.1Gorai.006G262900.1Gorai.005G111300.1Gorai.006G205600.1
Gorai.002G125000.1Gorai.008G202800.1Gorai.002G255700.1Gorai.004G281100.1Gorai.004G281000.1
Gorai.004G281300.1Gorai.004G281200.1Gorai.006G262800.1
Linum usitatissimumLus10024342Lus10015949Lus10030798Lus10012979Lus10011110
Lus10024312Lus10011111Lus10043231Lus10011109Lus10043230
Lus10034959Lus10012981
Malus domesticaMDP0000263222MDP0000933146MDP0000646516MDP0000307326MDP0000896660
MDP0000267976MDP0000260251MDP0000241709MDP0000308649MDP0000449901
Manihot esculentacassava4.1_005270mcassava4.1_026071mcassava4.1_004735mcassava4.1_025197mcassava4.1_028841m
cassava4.1_004927mcassava4.1_023659mcassava4.1_027132m
Medicago truncatulaMedtr5g038410.1Medtr7g114530.1Medtr1g023570.1Medtr8g102900.1Medtr6g088300.1
Mimulus guttatusmgv1a004290mmgv1a021812mmgv1a024085mmgv1a004035mmgv1a003984m
mgv1a002908mmgv1a027114m
Oryza sativaLOC_Os03g15320.1LOC_Os01g48540.1LOC_Os11g06870.1LOC_Os05g48520.1
Panicum virgatumPavirv00053055mPavirv00012056mPavirv00004365mPavirv00023087mPavirv00049090m
Pavirv00010844mPavirv00050515mPavirv00034533mPavirv00031618m
Physcomitrella patensPp1s91_94V6.1Pp1s27_70V6.1Pp1s376_5V6.1Pp1s144_105V6.1Pp1s58_157V6.2
Pp1s58_157V6.1Pp1s408_24V6.1Pp1s183_100V6.1Pp1s1_343V6.2Pp1s78_90V6.1
Pp1s30_238V6.1Pp1s21_324V6.1Pp1s43_101V6.1Pp1s119_38V6.1Pp1s149_297V6.1
Pp1s172_1V6.1Pp1s53_16V6.1Pp1s217_43V6.1Pp1s36_150V6.1Pp1s1_232V6.1
Pp1s36_144V6.1Pp1s173_129V6.1Pp1s52_249V6.1Pp1s838_1V6.1Pp1s201_96V6.1
Pp1s56_214V6.1Pp1s1_343V6.1Pp1s70_122V6.1Pp1s143_112V6.1Pp1s12_143V6.1
Pp1s333_30V6.1Pp1s97_6V6.1Pp1s227_29V6.1Pp1s95_56V6.1Pp1s466_4V6.1
Phaseolus vulgarisPhvul.010G012100.1Phvul.002G066900.1Phvul.006G098100.1Phvul.009G014800.1Phvul.001G009200.1
Phvul.009G171700.1Phvul.009G014900.1Phvul.002G311300.1Phvul.004G168600.1
Picea abiesMA_187092g0010MA_412851g0010MA_460865g0010MA_56166g0010MA_138024g0010
MA_126260g0010MA_10436303g0010MA_10429735g0020MA_812690g0010MA_10437233g0040
MA_10429735g0010MA_65180g0010MA_22751g0010MA_10437233g0030MA_8764g0010
MA_10437233g0020MA_162584g0010MA_10433917g0010MA_658171g0010MA_437873g0010
MA_190917g0010
Populus trichocarpaPotri.016G103400.1Potri.005G047700.1Potri.T122300.1Potri.010G034200.1Potri.005G235500.1
Potri.002G027000.1Potri.005G235600.1Potri.013G034900.1Potri.001G083600.1Potri.006G160800.1
Potri.018G084200.1Potri.005G235500.2
Prunus persicappa003992mppa020922mppa003824mppa026498mppa004709m
ppa023406mppa004880mppa024999mppa023837m
Ricinus communis30170.m01414129736.m00204130128.m00864830068.m00258029912.m005477
Setaria italicaSi039186mSi028244mSi004698mSi024932mSi039059m
Si009806m
Selaginella moellendorffii2311198985244165141395977682
Sorghum bicolorSb01g040550.1Sb03g031030.1Sb06g021520.1Sb05g004490.1Sb09g028310.1
Sb08g004430.1
Thellungiella halophilaThhalv10023396mThhalv10018361mThhalv10007284mThhalv10007241mThhalv10013037m
Thhalv10018300mThhalv10012975m
Vitis viniferaGSVIVT01019657001GSVIVT01015345001.99.625GSVIVT01009837001GSVIVT01021883001
Volvox carteriVocar20012997mVocar20008016mVocar20003050mVocar20012921mVocar20012673m
Vocar20007701mVocar20010749mVocar20006807mVocar20007569m.41.551Vocar20007569m.41.551
Vocar20010653mVocar20010521mVocar20010943m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)