y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT3G55140.1
FamilyPL1
Protein PropertiesLength: 332 Molecular Weight: 37186 Isoelectric Point: 7.4978
ChromosomeChromosome/Scaffold: 3 Start: 20438772 End: 20440429
Descriptionpectate lyase family protein, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1622400
  VFAVSGTINLNSYLSVSSYKTIDGRGQRIKLTGKGIRLKECEHIIICNLEFEGGRGHDVDGIQIKPKSRHIWIDRCSLRDYDDGLIDITRQSTDITVSRC
  YFAQHDKTMLIGADPSHVEDRCIRVTIHHCFFDGTRQRQPRLRFGKVHLYNNYTRNWGIYAVCASVEAQVFSQCNIYEA
Full Sequence
Protein Sequence     Length: 332     Download
MTSLPYADAD CSLRALAGRA EGFGRFAVGG LHGDLYVVTS LADDGPGTLR EGGRRKEPLW    60
IVFAVSGTIN LNSYLSVSSY KTIDGRGQRI KLTGKGIRLK ECEHIIICNL EFEGGRGHDV    120
DGIQIKPKSR HIWIDRCSLR DYDDGLIDIT RQSTDITVSR CYFAQHDKTM LIGADPSHVE    180
DRCIRVTIHH CFFDGTRQRQ PRLRFGKVHL YNNYTRNWGI YAVCASVEAQ VFSQCNIYEA    240
GVKKKTFEYY SEKAADKEEA RTGLVRSEND LFLNGAQPSL MTGASEECVF HPSEHYPTWT    300
VEPPSETLKQ IMQICTGWQS LSRPSDHGVP K*                                  360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C2.0e-3956236201+
COG3866PelB6.0e-4928307299+
smart00656Amb_all9.0e-6975241179+
Gene Ontology
GO TermDescription
GO:0016829lyase activity
GO:0030570pectate lyase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB75748.1013311341pectate lyase-like protein [Arabidopsis thaliana]
RefSeqNP_191074.2013311331pectate lyase family protein [Arabidopsis thaliana]
RefSeqNP_974439.104133117307pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002311134.1013251325predicted protein [Populus trichocarpa]
RefSeqXP_002526780.1013121312Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B2.00386e-431629421324A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A2.00386e-431629421324A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A2e-262823822246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A1e-2477238130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A2e-225723946247A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG177860304213240
DY27528232813260
DY27727531043130
DW066041301253250
DY277275223053260.22
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)