y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT4G01130.1
FamilyCE16
Protein PropertiesLength: 383 Molecular Weight: 42013.4 Isoelectric Point: 9.1939
ChromosomeChromosome/Scaffold: 4 Start: 485833 End: 488007
DescriptionGDSL-like lipase/acylhydrolase, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE16363612.3e-24
  FNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPFLSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQL
  NQMKQFKVNVDESHSLDRPGLKILPSKIVFGKSLYTFYIGQNDFTSNLASIGVERVKLYLPQVIGQIAGTIKEIYGIGGRTFLVLNLAPVGCYPAILTGY
  THTDADLDKYGCLIPVNKAVKYYNTLLNKTLSQTRTELKNATVIYLDTHKILLDLFQHPKSYGMKHGIKACCGYGGRPYNFNQKLFCGNTKVIGNFSTTA
  KACHDPHNYVSWDGIHATEAANHHIS
Full Sequence
Protein Sequence     Length: 383     Download
MASDINRRRS FSLLVLIIVM LYGHKGDSKC DFEAIFNFGD SNSDTGGFWA AFPAQSGPWG    60
MTYFKKPAGR ASDGRLIIDF LAKSLGMPFL SPYLQSIGSD FRHGANFATL ASTVLLPNTS    120
LFVSGISPFS LAIQLNQMKQ FKVNVDESHS LDRPGLKILP SKIVFGKSLY TFYIGQNDFT    180
SNLASIGVER VKLYLPQVIG QIAGTIKEIY GIGGRTFLVL NLAPVGCYPA ILTGYTHTDA    240
DLDKYGCLIP VNKAVKYYNT LLNKTLSQTR TELKNATVIY LDTHKILLDL FQHPKSYGMK    300
HGIKACCGYG GRPYNFNQKL FCGNTKVIGN FSTTAKACHD PHNYVSWDGI HATEAANHHI    360
SMAILDGSIS YPPFILNNLC SP*                                            420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00657Lipase_GDSL3.0e-18149364222+
PLN03156PLN031562.0e-2510365368+
cd01846fatty_acyltransferase_like3.0e-2838366332+
cd01837SGNH_plant_lipase_like1.0e-10834368342+
Gene Ontology
GO TermDescription
GO:0004091carboxylesterase activity
GO:0006629lipid metabolic process
GO:0012505endomembrane system
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB61024.1013821367similar to the GDSL family of lipolytic enzymes [Arabidopsis thaliana]
DDBJBAF01373.10202671248putative acetyltransferase [Arabidopsis thaliana]
RefSeqNP_192022.1013821382acetylesterase, putative [Arabidopsis thaliana]
RefSeqXP_002320844.102838022374predicted protein [Populus trichocarpa]
RefSeqXP_002511954.10937415379Esterase precursor, putative [Ricinus communis]
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG48662630713070
EG486627279603380
DR28181723712370
BM98601126612660
FD985136242382790
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00316.1Aquca_003_00419.2Aquca_026_00042.1Aquca_003_00426.1Aquca_081_00039.1
Aquca_037_00027.1Aquca_056_00007.2Aquca_056_00007.1Aquca_011_00355.1Aquca_040_00030.1
Aquca_037_00028.1Aquca_040_00028.1Aquca_056_00007.4Aquca_056_00007.3Aquca_026_00039.1
Arabidopsis lyrata474829334218864389474754485206
909410
Arabidopsis thalianaAT1G54790.3AT1G56670.1AT1G09390.1AT1G54790.1AT3G48460.1
AT1G54790.2AT5G14450.1
Brachypodium distachyonBradi2g25920.4Bradi2g25920.1Bradi2g45280.1
Brassica rapaBra020025Bra038972Bra019545Bra018056Bra040640
Bra030108Bra008757Bra039455Bra027918
Carica papayaevm.model.supercontig_184.1evm.model.supercontig_4.64
Capsella rubellaCarubv10020428mCarubv10001068mCarubv10011694mCarubv10020463mCarubv10017363m
Carubv10003515m
Citrus clementinaCiclev10020570mCiclev10000365mCiclev10023404m
Citrus sinensisorange1.1g017185morange1.1g016679morange1.1g017691morange1.1g018055morange1.1g016356m
Cucumis sativusCucsa.091760.1Cucsa.090420.1Cucsa.340130.1Cucsa.135890.1
Eucalyptus grandisEucgr.H01304.1Eucgr.B03271.1Eucgr.H02485.1Eucgr.D02341.2Eucgr.D02341.1
Fragaria vescamrna09914.1-v1.0-hybridmrna00284.1-v1.0-hybridmrna18929.1-v1.0-hybridmrna27870.1-v1.0-hybridmrna22302.1-v1.0-hybrid
Glycine maxGlyma16g03210.1Glyma07g06640.2Glyma07g06640.1Glyma17g18170.2Glyma03g40021.1
Glyma19g42560.2Glyma17g18170.1Glyma03g41580.1Glyma10g29820.1Glyma17g13600.1
Glyma03g40021.2Glyma05g02950.1Glyma19g42560.1Glyma16g07450.1Glyma08g13990.1
Glyma03g38890.1Glyma19g29810.1Glyma19g41470.1
Gossypium raimondiiGorai.007G294300.2Gorai.004G083600.3Gorai.004G083600.1Gorai.005G176800.1Gorai.007G105000.1
Gorai.011G094400.2Gorai.011G094400.1Gorai.008G204600.1Gorai.007G294300.1Gorai.011G094300.1
Gorai.004G083600.2
Linum usitatissimumLus10029980Lus10029639Lus10012644Lus10029638Lus10034763
Malus domesticaMDP0000764366MDP0000312022MDP0000263077MDP0000242118MDP0000134380
Manihot esculentacassava4.1_009552mcassava4.1_010326mcassava4.1_010282mcassava4.1_009992m
Medicago truncatulaMedtr7g113860.1AC233577_14.1Medtr6g007090.1Medtr7g116870.1Medtr4g104240.1
Medtr1g030220.1Medtr7g111780.1
Mimulus guttatusmgv11b006860mmgv11b006645mmgv1a008086mmgv1a008044mmgv1a021460m
Oryza sativaLOC_Os10g25340.1LOC_Os05g33270.1LOC_Os03g62740.1LOC_Os05g04240.1LOC_Os06g06520.1
Panicum virgatumPavirv00029923m
Physcomitrella patensPp1s518_11V6.1
Phaseolus vulgarisPhvul.010G108700.1Phvul.006G094100.1Phvul.003G239200.1Phvul.007G182500.1Phvul.008G155800.1
Phvul.003G208000.1Phvul.001G223500.1
Picea abiesMA_9754208g0010MA_5197g0010MA_114950g0010MA_5042g0010MA_10331604g0010
MA_75971g0010MA_10433283g0020
Populus trichocarpaPotri.013G015200.1Potri.005G038800.1Potri.015G089700.1Potri.002G216000.1Potri.014G094100.1
Potri.005G038800.2Potri.005G006500.1Potri.005G006500.2
Prunus persicappa023404mppa017417mppa001667mppa016576mppa007674m
ppa007486mppa007411mppa017062m
Ricinus communis29703.m00154730147.m01380930076.m00459730128.m00895130174.m008697
Setaria italicaSi001849mSi001792mSi004937mSi030054mSi030025m
Si008678mSi024357mSi022330m
Selaginella moellendorffii115333123499410344441488410418
15238152494115316542865258
80611709886583334430
Sorghum bicolorSb03g029650.1Sb01g001540.1Sb10g004120.1Sb02g037820.1Sb09g019710.1
Thellungiella halophilaThhalv10023524mThhalv10023535mThhalv10007968mThhalv10028725mThhalv10010448m
Thhalv10013537mThhalv10020927m
Vitis viniferaGSVIVT01000007001GSVIVT01027038001
Zea maysAC212068.4_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)