y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT4G16260.1
FamilyGH17
Protein PropertiesLength: 345 Molecular Weight: 37711.5 Isoelectric Point: 6.8121
ChromosomeChromosome/Scaffold: 4 Start: 9200010 End: 9201552
Descriptionglycosyl hydrolases family 17, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17243340
  VGVCYGMMGNNLPSQSDTIALFRQNNIRRVRLYDPNQAALNALRNTGIEVIIGVPNTDLRSLTNPSSARSWLQNNVLNYYPAVSFKYIAVGNEVSPSNGG
  DVVLPAMRNVYDALRGANLQDRIKVSTAIDMTLIGNSFPPSSGEFRGDVRWYIDPVIGFLTSTNSALLANIYPYFSYVDNPRDISLSYALFTSPSVVVWD
  GSRGYQNLFDALLDVVYSAVERSGGGSLPVVVSESGWPSNGGNAASFDNARAFYTNLASRVRENRGTPKRPGRGVETYLFAMFDENQKSPEIEKNFGLFF
  PNKQPKFPITF
Full Sequence
Protein Sequence     Length: 345     Download
MTTLFLLIAL FITTILNPTS GESVGVCYGM MGNNLPSQSD TIALFRQNNI RRVRLYDPNQ    60
AALNALRNTG IEVIIGVPNT DLRSLTNPSS ARSWLQNNVL NYYPAVSFKY IAVGNEVSPS    120
NGGDVVLPAM RNVYDALRGA NLQDRIKVST AIDMTLIGNS FPPSSGEFRG DVRWYIDPVI    180
GFLTSTNSAL LANIYPYFSY VDNPRDISLS YALFTSPSVV VWDGSRGYQN LFDALLDVVY    240
SAVERSGGGS LPVVVSESGW PSNGGNAASF DNARAFYTNL ASRVRENRGT PKRPGRGVET    300
YLFAMFDENQ KSPEIEKNFG LFFPNKQPKF PITFSAARDG TAVE*                    360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53094.0e-623632294+
pfam00332Glyco_hydro_171.0e-15624334313+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005886plasma membrane
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP87281.10333918356beta-1,3-glucanase [Hevea brasiliensis]
GenBankABG49448.10333918356beta-1,3-glucanase [Hevea brasiliensis]
GenBankACZ74626.10233918356beta-1,3-glucanase [Hevea brasiliensis]
EMBLCAB10405.1012951299beta-1, 3-glucanase class I precursor [Arabidopsis thaliana]
RefSeqNP_193361.4013441344catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3f55_D0243352316A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3f55_C0243352316A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3f55_B0243352316A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3f55_A0243352316A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB3em5_D0243352316A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG523562268172840
ES904102284383210
EX135103278563330
EX134163277343100
EG514167255913450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00709.1Aquca_052_00037.1Aquca_014_00710.1Aquca_014_00708.1Aquca_014_00706.1
Aquca_004_00503.1Aquca_023_00065.1Aquca_077_00005.1Aquca_049_00226.1Aquca_004_00503.2
Aquca_049_00225.1
Arabidopsis lyrata329886348799877890486168910094
486169881625488942910095910074
899139316691856124488959
Arabidopsis thalianaAT1G77780.1AT3G57240.1AT5G20330.1AT3G57270.1AT5G20340.1
AT5G20390.1AT3G57260.1AT1G33220.1AT5G20560.1AT1G77790.1
Brachypodium distachyonBradi2g60490.1Bradi2g43056.1Bradi2g60441.1Bradi2g27140.1Bradi4g36190.1
Bradi2g21142.1Bradi2g60536.1Bradi2g60542.1Bradi1g15295.1Bradi2g22226.1
Bradi2g60557.1Bradi2g22224.1Bradi2g22222.1Bradi2g60497.1Bradi2g52565.1
Brassica rapaBra033549Bra007313Bra003273Bra007315Bra020110
Bra002311Bra002295Bra020100Bra014635Bra014638
Bra014636Bra015873Bra014640Bra008336Bra014637
Bra007314
Carica papayaevm.model.supercontig_69.53evm.model.supercontig_56.98evm.model.supercontig_49.125evm.model.supercontig_120.8evm.model.supercontig_120.1
evm.model.supercontig_120.2evm.model.supercontig_203.3evm.model.supercontig_49.124evm.model.supercontig_1107.1evm.model.supercontig_179.28
Capsella rubellaCarubv10005163mCarubv10020584mCarubv10017567mCarubv10018497mCarubv10003621m
Carubv10009618mCarubv10007632mCarubv10017587mCarubv10017580mCarubv10021473m
Carubv10003855m
Citrus clementinaCiclev10031945mCiclev10017983mCiclev10029843mCiclev10005195mCiclev10005181m
Ciclev10012099mCiclev10005316mCiclev10007126mCiclev10006922mCiclev10006479m
Ciclev10001717mCiclev10005324mCiclev10006634mCiclev10006696m
Citrus sinensisorange1.1g048613morange1.1g048190morange1.1g019260morange1.1g018955morange1.1g018966m
orange1.1g019014morange1.1g019755morange1.1g043874morange1.1g025491morange1.1g046047m
orange1.1g044365morange1.1g039749morange1.1g043422morange1.1g043818morange1.1g043597m
Cucumis sativusCucsa.167580.1Cucsa.333910.1Cucsa.356950.1Cucsa.274690.1Cucsa.333930.2
Cucsa.333930.1Cucsa.274680.1
Eucalyptus grandisEucgr.B03315.1Eucgr.L02807.1Eucgr.F03742.1
Fragaria vescamrna14817.1-v1.0-hybridmrna05145.1-v1.0-hybridmrna21959.1-v1.0-hybridmrna05671.1-v1.0-hybrid.230.538mrna05671.1-v1.0-hybrid.230.538
mrna12482.1-v1.0-hybridmrna14292.1-v1.0-hybridmrna14815.1-v1.0-hybridmrna17857.1-v1.0-hybrid
Glycine maxGlyma03g28870.1Glyma12g02410.1Glyma11g10080.1Glyma16g21710.1Glyma16g21740.2
Glyma11g10070.1Glyma16g21640.1Glyma09g04191.2Glyma09g04191.1Glyma06g11390.1
Glyma19g31580.1Glyma15g15200.1Glyma03g28850.1Glyma19g31590.2Glyma19g31590.1
Glyma09g04200.2Glyma11g10091.1Glyma16g21700.2Glyma15g15211.1
Gossypium raimondiiGorai.010G003600.1Gorai.010G003500.1Gorai.008G159300.1Gorai.009G074100.1Gorai.006G134700.1
Gorai.006G079600.1Gorai.009G242500.1Gorai.006G079400.1Gorai.004G257700.1Gorai.006G134600.1
Gorai.010G003700.1Gorai.008G159300.2.125.311Gorai.008G159300.2.125.311
Linum usitatissimumLus10029149Lus10013016Lus10039233Lus10014110Lus10016883
Lus10002807Lus10031037Lus10019801Lus10014108Lus10014109
Lus10027479Lus10010091Lus10027860Lus10035423Lus10019800
Lus10031035Lus10031033Lus10031036
Malus domesticaMDP0000256573MDP0000327191MDP0000918948MDP0000250870MDP0000576756
MDP0000298027MDP0000265527MDP0000570395MDP0000563788MDP0000796925
MDP0000834943MDP0000416440MDP0000880357MDP0000820007MDP0000282861.136.425
MDP0000282861.136.425MDP0000163547MDP0000127517MDP0000247130.244.451MDP0000247130.244.451
MDP0000521510
Manihot esculentacassava4.1_010983mcassava4.1_009799mcassava4.1_023576m
Medicago truncatulaMedtr4g076470.1Medtr2g034440.1Medtr4g076430.1Medtr4g076440.1Medtr2g034470.1
Medtr7g081370.1Medtr7g081350.1Medtr4g076570.1Medtr4g076490.1Medtr4g076500.1
Medtr2g034480.1Medtr4g076250.1
Mimulus guttatusmgv1a009451mmgv1a009099mmgv1a009184mmgv1a009606mmgv1a020557m
mgv1a009249mmgv1a009371mmgv1a026276m
Oryza sativaLOC_Os01g71340.1LOC_Os01g71400.1LOC_Os01g71860.1.324.630LOC_Os01g71860.1.324.630LOC_Os01g71930.1
LOC_Os01g71380.1LOC_Os01g51570.1LOC_Os01g71410.1LOC_Os09g36280.1LOC_Os01g58730.1
LOC_Os05g41610.1LOC_Os01g71830.1LOC_Os01g71810.1LOC_Os01g71820.1LOC_Os05g31140.1
LOC_Os01g71680.1LOC_Os01g71350.1LOC_Os05g31140.3LOC_Os05g31140.2LOC_Os01g71474.1
LOC_Os01g71670.1LOC_Os01g71690.3LOC_Os01g71690.2LOC_Os01g71650.1LOC_Os03g22530.1
LOC_Os03g56130.1LOC_Os07g41014.1
Panicum virgatumPavirv00070670mPavirv00014109mPavirv00036938mPavirv00057359mPavirv00029945m
Pavirv00002244mPavirv00000755mPavirv00069874mPavirv00015614mPavirv00007129m
Pavirv00070558mPavirv00053670mPavirv00025674mPavirv00022362mPavirv00016955m
Pavirv00026418mPavirv00033312mPavirv00058859m.81.297Pavirv00058859m.81.297Pavirv00052769m
Pavirv00052474mPavirv00000958mPavirv00064841mPavirv00000252mPavirv00057392m
Pavirv00015902mPavirv00070799mPavirv00070030m
Physcomitrella patensPp1s26_166V6.1
Phaseolus vulgarisPhvul.011G177000.1Phvul.011G077900.1Phvul.001G128500.1Phvul.009G256500.1Phvul.009G256400.2
Phvul.009G256400.1
Picea abiesMA_202096g0010MA_8691g0010.97.408MA_8691g0010.97.408MA_28098g0010MA_10266495g0010
MA_475809g0010MA_10432716g0010MA_10431609g0010MA_10432716g0030MA_10337257g0010
MA_8465203g0010MA_795943g0010MA_934111g0010
Populus trichocarpaPotri.001G255100.1Potri.016G057400.1Potri.006G048100.1Potri.016G057600.1Potri.005G172000.1
Potri.009G050300.1Potri.016G135900.1Potri.010G142800.1Potri.T167100.1Potri.010G142800.2
Potri.002G089200.1Potri.006G046100.1Potri.001G255100.2Potri.009G050400.2Potri.009G050400.1
Potri.010G088500.1
Prunus persicappa020503mppa024457mppa018225mppa007999mppa026579m
ppa025430mppa023845mppa1027220mppa017239mppa008126m
ppa015919mppa017802mppa024064mppa024759mppa020193m
Ricinus communis29676.m00166629908.m00619130169.m00647429631.m00102330053.m000106
30147.m013731.50.28430147.m013731.50.284
Setaria italicaSi002182mSi002306mSi028122mSi022625mSi002065m
Si022492mSi003802mSi000491mSi004560mSi005124m
Si022606mSi024558mSi022731mSi022614mSi002273m
Si022794mSi022791m
Selaginella moellendorffii233178
Sorghum bicolorSb03g045460.1Sb03g045450.1Sb08g019670.1Sb02g030930.1Sb09g024320.1
Sb03g037270.1Sb03g045630.1Sb09g018730.2Sb09g018730.1Sb03g045510.1
Sb09g025890.1Sb09g018730.4Sb09g018730.3Sb03g045490.1Sb09g018750.1
Sb03g045480.1Sb03g045520.1
Thellungiella halophilaThhalv10025628mThhalv10003127mThhalv10019644mThhalv10015407mThhalv10007971m
Thhalv10003126mThhalv10015636mThhalv10015248mThhalv10008546m
Vitis viniferaGSVIVT01013131001GSVIVT01033545001.34.314GSVIVT01033545001.34.314GSVIVT01033542001GSVIVT01033536001
GSVIVT01031542001.119.325GSVIVT01031542001.119.325GSVIVT01033538001GSVIVT01033545001.379.572GSVIVT01033545001.379.572
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)