y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT4G33860.1
FamilyCBM22
Protein PropertiesLength: 577 Molecular Weight: 65211 Isoelectric Point: 8.751
ChromosomeChromosome/Scaffold: 4 Start: 16229948 End: 16232334
Descriptionglycosyl hydrolase family 10 protein, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM22461615.4e-21
  IIVSPDVRDGTLGWTPFGNAKVDFRKIGNHNFFVARDRKQPFDSVSQKVYLEKGLLYTFSAWLQVSKGKAPVKAVFKKNGEYKLAGSVVAESKCWSMLKG
  GLTVDESGPAELYFES
GH102224800
  KLGFPFGCEVEKNILGNKAYQNWFTQRFTVTTFANEMKWYSTEVVRGKEDYSTADAMLRFFKQHGVAVRGHNILWNDPKYQPKWVNALSGNDLYNAVKRR
  VFSVVSRYKGQLAGWDVVNENLHFSYFEDKMGPKASYNIFKMAQAFDPTTTMFMNEYNTLEESSDSDSSLARYLQKLREIRSIRVCGNISLGIGLESHFK
  TPNIPYMRSALDTLAATGLPIWLTEVDVEAPPNVQAKYFEQVLREGHAHPQVKGIVTWS
Full Sequence
Protein Sequence     Length: 577     Download
MKRLLLLVVL CSLSLSRCES KVVPYDYSAT IECLEIPLKP QYNGGIIVSP DVRDGTLGWT    60
PFGNAKVDFR KIGNHNFFVA RDRKQPFDSV SQKVYLEKGL LYTFSAWLQV SKGKAPVKAV    120
FKKNGEYKLA GSVVAESKCW SMLKGGLTVD ESGPAELYFE SEDTTVEIWV DSVSLQPFTQ    180
EEWNSHHEQS IQKERKRTVR IRAVNSKGEP IPKATISIEQ RKLGFPFGCE VEKNILGNKA    240
YQNWFTQRFT VTTFANEMKW YSTEVVRGKE DYSTADAMLR FFKQHGVAVR GHNILWNDPK    300
YQPKWVNALS GNDLYNAVKR RVFSVVSRYK GQLAGWDVVN ENLHFSYFED KMGPKASYNI    360
FKMAQAFDPT TTMFMNEYNT LEESSDSDSS LARYLQKLRE IRSIRVCGNI SLGIGLESHF    420
KTPNIPYMRS ALDTLAATGL PIWLTEVDVE APPNVQAKYF EQVLREGHAH PQVKGIVTWS    480
GYSPSGCYRM CLTDGNFKNV PTGDVVDKLL HEWGGFRRQT TGVTDADGYF EASLFHGDYD    540
LKIAHPLTNS KASHSFKLTS DVSSSQNQPS SFVFRV*                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_94.0e-654164121+
COG3693XynA1.0e-30249479252+
pfam00331Glyco_hydro_101.0e-47225479273+
smart00633Glyco_106.0e-82258506272+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0012505endomembrane system
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAA19866.1026576119669putative protein [Arabidopsis thaliana]
EMBLCAA19866.103985052109putative protein [Arabidopsis thaliana]
EMBLCAA19868.103757622574putative protein [Arabidopsis thaliana]
RefSeqNP_195110.301657616576glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
RefSeqNP_195112.2015761576glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nq6_A3e-3022750615298A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB2g4f_B8e-272124791266A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB2g4f_A8e-272124791266A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB2g3j_A8e-272124791266A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB2g3i_A8e-272124791266A Chain A, Structure Of S.Olivaceoviridis Xylanase Q88aR275A MUTANT
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR454025236192540
DR353177217752910
EX2661282782405150
GE4715972911594490
EX266128415225580.049
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00218.1.27.143Aquca_011_00219.1.49.165
Arabidopsis lyrata913024.46.162491295.46.161
Arabidopsis thalianaAT4G33840.1.46.161AT4G33830.1.47.162AT4G33860.1.46.161
Brachypodium distachyonBradi1g71040.1.54.172
Brassica rapaBra034585.47.155Bra034584.46.161Bra017609.141.256
Carica papayaevm.model.supercontig_106.45.53.168
Capsella rubellaCarubv10006586m.46.161
Citrus clementinaCiclev10030382m.52.167
Fragaria vescamrna28152.1-v1.0-hybrid.50.168
Glycine maxGlyma11g11200.1.73.188Glyma11g11220.1.35.152
Linum usitatissimumLus10020985.24.142Lus10033786.35.153Lus10014642.40.158
Malus domesticaMDP0000245498.55.170
Manihot esculentacassava4.1_021918m.41.156
Mimulus guttatusmgv1a003597m.49.165
Oryza sativaLOC_Os03g10478.1.55.172LOC_Os03g10440.1.51.167
Panicum virgatumPavirv00027101m.14.130Pavirv00026745m.37.153
Phaseolus vulgarisPhvul.011G033100.1.41.156
Picea abiesMA_429144g0010.58.183MA_10434167g0010MA_7941351g0010
Populus trichocarpaPotri.009G087900.1.27.142
Prunus persicappa021363m.43.158
Ricinus communis29812.m000195.44.159
Setaria italicaSi034867m.54.170Si034912m.47.163
Selaginella moellendorffii420481.76.197
Thellungiella halophilaThhalv10024995m.45.160Thhalv10027468m.47.162
Vitis viniferaGSVIVT01037833001.70.185GSVIVT01037825001.23.138
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny