y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT4G34215.2
FamilyCE6
Protein PropertiesLength: 261 Molecular Weight: 28358.2 Isoelectric Point: 5.8519
ChromosomeChromosome/Scaffold: 4 Start: 16379603 End: 16381302
Descriptionreceptor protein kinase, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE6931899.4e-30
  GPGMAFANAVKNRLETDSAVIGLVPCASGGTAIKEWERGSHLYERMVKRTEESRKCGGEIKAVLWYQGESDVLDIHDAESYGNNMDRLIKNLRHDLN
Full Sequence
Protein Sequence     Length: 261     Download
MEGGSITPGE DKPEIQSPIP PNQIFILSGQ SNMAGRGGVF KDHHNNRWVW DKILPPECAP    60
NSSILRLSAD LRWEEAHEPL HVDIDTGKVC GVGPGMAFAN AVKNRLETDS AVIGLVPCAS    120
GGTAIKEWER GSHLYERMVK RTEESRKCGG EIKAVLWYQG ESDVLDIHDA ESYGNNMDRL    180
IKNLRHDLNL PSLPIIQVAI ASGGGYIDKV REAQLGLKLS NVVCVDAKGL PLKSDNLHLT    240
TEAQVQLGLS LAQAYLSNFC *                                              300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03629DUF3038.0e-4223256288+
Gene Ontology
GO TermDescription
GO:0005575cellular_component
GO:0008150biological_process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2APJ012601260A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
GenBankAAM65927.1012601260unknown [Arabidopsis thaliana]
EMBLCAA17550.101201776976receptor protein kinase-like protein [Arabidopsis thaliana]
RefSeqNP_567960.1012601260hydrolase [Arabidopsis thaliana]
RefSeqXP_002300236.10222571235predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2apj_D012601260A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_C012601260A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_B012601260A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_A012601260A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB1zmb_F9e-22252575226A Chain A, Crystal Structure Of The Putative Acetylxylan Esterase From Clostridium Acetobutylicum, Northeast Structural Genomics Target Car6
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AJ60934625012500
EV13704723152300
EG525975186762610
FG56470522012140
DR355070172902610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00771.1Aquca_007_00771.2Aquca_083_00065.1Aquca_007_00769.2Aquca_007_00769.1
Aquca_083_00064.1
Arabidopsis lyrata491251485676
Arabidopsis thalianaAT4G34215.1AT3G53010.1
Brachypodium distachyonBradi1g00920.1Bradi5g01970.1Bradi5g03767.1
Brassica rapaBra019633Bra011507Bra006967
Carica papayaevm.model.supercontig_21.147evm.model.supercontig_106.87
Capsella rubellaCarubv10017718m
Citrus clementinaCiclev10029126mCiclev10001964m
Citrus sinensisorange1.1g031029morange1.1g041680m
Cucumis sativusCucsa.219410.1Cucsa.352550.1Cucsa.363600.1Cucsa.395900.1Cucsa.118670.1
Cucsa.131470.1Cucsa.395910.1
Eucalyptus grandisEucgr.F02296.1Eucgr.F02295.1Eucgr.F00179.1Eucgr.F02298.1Eucgr.H03219.1
Fragaria vescamrna26277.1-v1.0-hybridmrna00187.1-v1.0-hybridmrna00186.1-v1.0-hybrid
Glycine maxGlyma04g04480.1Glyma06g04600.2Glyma20g26520.1Glyma14g09520.2
Gossypium raimondiiGorai.009G215800.2Gorai.009G215800.1Gorai.009G276300.1Gorai.002G009200.3Gorai.002G009200.2
Gorai.002G009200.1Gorai.010G023400.1Gorai.010G023300.1
Linum usitatissimumLus10014097Lus10019817Lus10001129Lus10001128Lus10042634
Malus domesticaMDP0000268373MDP0000232743MDP0000659790
Manihot esculentacassava4.1_017032mcassava4.1_014751mcassava4.1_012755mcassava4.1_028741mcassava4.1_023715m
Medicago truncatulaMedtr3g102390.1Medtr1g018750.1Medtr4g031010.1
Mimulus guttatusmgv1a011596mmgv1a011640mmgv1a012327mmgv1a011466mmgv1a024902m
mgv1a012748m
Oryza sativaLOC_Os03g64030.1LOC_Os04g20810.3LOC_Os04g20810.2LOC_Os04g20810.1LOC_Os03g64050.1
LOC_Os04g01980.1
Panicum virgatumPavirv00050725mPavirv00054854mPavirv00001245mPavirv00015379mPavirv00041774m
Pavirv00024018mPavirv00052298m
Physcomitrella patensPp1s22_274V6.1
Phaseolus vulgarisPhvul.009G067900.1Phvul.007G040500.1Phvul.001G025100.1
Picea abiesMA_10266583g0010MA_10429498g0010
Populus trichocarpaPotri.001G300800.2Potri.001G300800.1Potri.009G096400.2Potri.009G096400.1Potri.014G022600.1
Potri.014G022700.2Potri.014G022700.1
Prunus persicappa018867mppa010380mppa015335m
Ricinus communis30170.m01421430170.m01378629801.m003105
Setaria italicaSi037070mSi018083mSi037046mSi018268mSi037217m
Si010984mSi010752m
Selaginella moellendorffii122285
Sorghum bicolorSb02g011020.1Sb01g000550.1Sb01g000530.1Sb06g006110.1Sb06g000860.1
Thellungiella halophilaThhalv10026018mThhalv10010602m
Vitis viniferaGSVIVT01003163001GSVIVT01009426001GSVIVT01009427001
Zea maysAC203966.5_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)