y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT5G09760.1
FamilyCE8
Protein PropertiesLength: 552 Molecular Weight: 60438.8 Isoelectric Point: 6.3215
ChromosomeChromosome/Scaffold: 5 Start: 3032375 End: 3034543
Descriptionpectinesterase, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82405420
  DVTVCKDGKCGYKTVQDAVNAAPEDNGMRKFVIKISEGVYEENVIVPFEKKNVVFIGDGMGKTVITGSLNAGMPGITTYNTATVGVVGDGFMARDLTFQN
  TAGPDAHQAVAFRSDSDFSLIENCEFLGNQDTLYAHGLRQFYKNCRIQGNVDFIFGNSAAVFQDCEILIAPRQINPEKGEKNAVTAQGRIDPSQSTGFVF
  LNCLINGTEEYMKLFKANPKVHKNFLGRPWKDYSRTVFIGCNLEALITPDGWLPWSGDFALKTLYYGESKNTGPGSDRSQRVSWSSQIPDEHVHVYSVAN
  FIQ
Full Sequence
Protein Sequence     Length: 552     Download
MSSILILLFS LFLFSSPSSS SRHHHHHNSG DTSPVNPSSS LAAQIRLACN ATRYPDQCVS    60
SLSEQGRVPP DPKPIQIIHS AISFSFQNLK TAQSKIKSIV DSSVGNLNRT NAANTCLQLL    120
TYSEHRTQST DQALTRGKIK DARAWMSAAL VYQYDSWSAL KYVNDTSQVG ETMSFLDGLI    180
HVTSNALSMM VSYDNFGDNV ASWTYPATER DGFWEKTGPG LGLDPSTGLN LGFPSGLKED    240
VTVCKDGKCG YKTVQDAVNA APEDNGMRKF VIKISEGVYE ENVIVPFEKK NVVFIGDGMG    300
KTVITGSLNA GMPGITTYNT ATVGVVGDGF MARDLTFQNT AGPDAHQAVA FRSDSDFSLI    360
ENCEFLGNQD TLYAHGLRQF YKNCRIQGNV DFIFGNSAAV FQDCEILIAP RQINPEKGEK    420
NAVTAQGRID PSQSTGFVFL NCLINGTEEY MKLFKANPKV HKNFLGRPWK DYSRTVFIGC    480
NLEALITPDG WLPWSGDFAL KTLYYGESKN TGPGSDRSQR VSWSSQIPDE HVHVYSVANF    540
IQADEWASMS A*                                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02745PLN027452.0e-10831550541+
PLN02713PLN027138.0e-10933546557+
PLN02301PLN023015.0e-11789546475+
pfam01095Pectinesterase4.0e-172240544308+
PLN02708PLN02708030551522+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0009505plant-type cell wall
GO:0009507chloroplast
GO:0030599pectinesterase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB09534.101755143577pectin methylesterase-like protein [Arabidopsis thaliana]
RefSeqNP_196538.1015511551pectinesterase family protein [Arabidopsis thaliana]
RefSeqNP_568991.202455163602pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002275218.102054644568PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281640.1015461550PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02355233281A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02405464303B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B1e-1724646914245B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A1e-1724646914245B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B1e-1724646914245B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES9096392602935520
FY4394602542995520
EV5357492522565070
EV1228232413115510
CN7260442433055470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)