y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT5G38460.1
FamilyGT57
Protein PropertiesLength: 534 Molecular Weight: 61112.7 Isoelectric Point: 9.0137
ChromosomeChromosome/Scaffold: 5 Start: 15398284 End: 15401026
Descriptionglucosyltransferase, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57505120
  LLIRSAVTMYPYSGAGIPPKFGDFEAQRHWMEITTNLPVIDWYRNGTYNDLTYWGLDYPPLTAYQSYIHGIFLRFFNPESVALLSSRGHESYLGKLLMRW
  TVLSSDAFIFFPAALFFVLVYHRNRTRGGKSEVAWHIAMILLNPCLILIDHGHFQYNCISLGLTVGAIAAVLCESEVLTCVLFSLALSHKQMSAYFAPAF
  FSHLLGKCLRRKSPILSVIKLGIAVIVTFVIFWWPYVHSLDDFLMVLSRLAPFERGIYEDYVANFWCTTSILIKWKNLFTTQSLKSISLAATILASLPSM
  VQQILSPSNEGFLYGLLNSSMAFYLFSFQVHEKSILMPFLSATLLALKLPDHFSHLTYYALFSMFPLLCRDKLLIPYLTLSFLFTVIYHSPGNHHAIQKT
  DVSFFSFKNFPGYVFLLRTHFFISVVLHVLYLTIKPPQKYPFLFEALIMILCFSYFIMFAFYT
Full Sequence
Protein Sequence     Length: 534     Download
MPKKKPAKHS GEDDITIPVS PQTGSSIDTW WWLTHKGTTT SFLCISLFAL LIRSAVTMYP    60
YSGAGIPPKF GDFEAQRHWM EITTNLPVID WYRNGTYNDL TYWGLDYPPL TAYQSYIHGI    120
FLRFFNPESV ALLSSRGHES YLGKLLMRWT VLSSDAFIFF PAALFFVLVY HRNRTRGGKS    180
EVAWHIAMIL LNPCLILIDH GHFQYNCISL GLTVGAIAAV LCESEVLTCV LFSLALSHKQ    240
MSAYFAPAFF SHLLGKCLRR KSPILSVIKL GIAVIVTFVI FWWPYVHSLD DFLMVLSRLA    300
PFERGIYEDY VANFWCTTSI LIKWKNLFTT QSLKSISLAA TILASLPSMV QQILSPSNEG    360
FLYGLLNSSM AFYLFSFQVH EKSILMPFLS ATLLALKLPD HFSHLTYYAL FSMFPLLCRD    420
KLLIPYLTLS FLFTVIYHSP GNHHAIQKTD VSFFSFKNFP GYVFLLRTHF FISVVLHVLY    480
LTIKPPQKYP FLFEALIMIL CFSYFIMFAF YTNYTQWTLS SHFGSSDKEK KQI*          540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg86.0e-11849514478+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016757transferase activity, transferring glycosyl groups
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001145139.103253023517hypothetical protein LOC100278369 [Zea mays]
RefSeqNP_198662.1015331533ALG6, ALG8 glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002280181.101953310516PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.105353115489predicted protein [Populus trichocarpa]
RefSeqXP_002329281.105353111484predicted protein [Populus trichocarpa]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5470EC-2.4.1.267Dol-P-Glc:Man9GlcNAc2-PP-Dol α-1,3-glucosyltransferase
Transmembrane Domains
StartEnd
4264
147169
182204
214236
264286
360377
422441
461483
490512
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT559534277222970
DN6203322721484190
FS330727234312640
AV82738918411840
EE54704022832290
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2Gorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny