y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT5G57500.1
FamilyGT31
Protein PropertiesLength: 319 Molecular Weight: 36961.6 Isoelectric Point: 7.4925
ChromosomeChromosome/Scaffold: 5 Start: 23286237 End: 23287571
Descriptionhypro1, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT31842524.5e-31
  RRHFLRMIYGTQNVPDGVKVDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDIFNETDAQKPPYHYVMKADDDTYIRLESL
  VASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIAVWLKDSEIPKKHLEGPEDKVFGDWIRE
Full Sequence
Protein Sequence     Length: 319     Download
MKSSPRSEGR KFIIPSFFFI IALCVLAFIN EIRFDSLLSF GRCALSNVPM NNGSSETPLL    60
SSSPVDDEIR ILIGILTLPD QYSRRHFLRM IYGTQNVPDG VKVDVKFVFC NLTKEDQKVL    120
VALEIMRYDD IIILNCNENM NKGKTYTYFS SLPDIFNETD AQKPPYHYVM KADDDTYIRL    180
ESLVASLRPL PREDLYYGYV IPCPSMDPFV HYMSGMGYLV SWDIAVWLKD SEIPKKHLEG    240
PEDKVFGDWI REGRRGKNRF NAKWSMYNFP EPPTRCTHEL WPDTIAVHLL KNQEKWIRTL    300
NYFNVTSNLK PSKLYHIP*                                                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PTZ00210PTZ002100.00116420037+
PLN03133PLN031333.0e-5168256113+
pfam01762Galactosyl_T2.0e-983225170+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0012505endomembrane system
GO:0016020membrane
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM61378.1013181318unknown [Arabidopsis thaliana]
EMBLCAN80704.102431824318hypothetical protein [Vitis vinifera]
RefSeqNP_200558.1013181318transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002269659.102431843337PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325062.1013181320predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
1229
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FD57822223212320
FD5824062111093190
EC939282253673190
EC938024248723190
CU530544249292770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_096_00011.1Aquca_096_00008.1Aquca_096_00010.1Aquca_002_01354.1
Arabidopsis lyrata918927
Brachypodium distachyonBradi4g30950.1Bradi3g60170.1Bradi2g15440.1Bradi2g15450.1Bradi2g15460.1
Bradi2g17360.1Bradi4g04430.1Bradi4g16710.1Bradi4g30940.1
Brassica rapaBra002724Bra006816
Carica papayaevm.model.supercontig_52.13
Capsella rubellaCarubv10026744m
Citrus clementinaCiclev10010309m
Citrus sinensisorange1.1g020721m
Cucumis sativusCucsa.092450.1
Eucalyptus grandisEucgr.C00164.1
Fragaria vescamrna04896.1-v1.0-hybridmrna05246.1-v1.0-hybridmrna04895.1-v1.0-hybrid
Glycine maxGlyma13g01060.1Glyma17g07150.1Glyma12g20860.1
Gossypium raimondiiGorai.004G100500.1
Linum usitatissimumLus10015527Lus10000372Lus10006963Lus10000407Lus10019998
Manihot esculentacassava4.1_024374m
Medicago truncatulaMedtr4g128310.1
Mimulus guttatusmgv1a025682mmgv1a018717mmgv1a021117m
Oryza sativaLOC_Os09g26330.1LOC_Os02g54390.1LOC_Os09g26320.1LOC_Os02g54370.1LOC_Os05g47880.1
LOC_Os02g54450.1LOC_Os09g26310.1LOC_Os09g26300.1LOC_Os06g09270.1LOC_Os02g54420.1
Panicum virgatumPavirv00040114mPavirv00020399mPavirv00061634mPavirv00009580mPavirv00040113m
Pavirv00047142mPavirv00009581mPavirv00040592mPavirv00020786mPavirv00027671m
Pavirv00062025mPavirv00047141mPavirv00070843m
Physcomitrella patensPp1s111_120V6.1Pp1s111_120V6.2Pp1s111_120V6.3Pp1s121_91V6.1
Phaseolus vulgarisPhvul.003G146700.1
Picea abiesMA_877072g0010MA_119164g0010MA_118743g0010
Populus trichocarpaPotri.007G131000.1Potri.018G094000.1
Prunus persicappa015950mppa025342mppa022137m
Setaria italicaSi030530mSi019701mSi030596mSi022442mSi019638m
Si008283m
Sorghum bicolorSb09g027700.1Sb04g035240.1Sb02g025430.1Sb10g006180.1Sb04g035250.1
Sb02g025420.1
Thellungiella halophilaThhalv10014129m
Vitis viniferaGSVIVT01038267001GSVIVT01029188001GSVIVT01029189001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)