y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT5G61250.1
FamilyGH79
Protein PropertiesLength: 540 Molecular Weight: 59864.5 Isoelectric Point: 8.1369
ChromosomeChromosome/Scaffold: 5 Start: 24632154 End: 24634805
Descriptionheparanase-like protein precursor, putative, expressed
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH79415330
  DENFICATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAIQAFRTLRIRIGGSLQDQVIYDVGDLKTPCTQFKKTDDGLFGFSEGCLYMKRWDEVNH
  FFNATGAIVTFGLNALHGRNKLNGTAWGGDWDHTNTQDFMNYTVSKGYAIDSWEFGNELSGSGIWASVSVELYGKDLIVLKNVIKNVYKNSRTKPLVVAP
  GGFFEEQWYSELLRLSGPGVLDVLTHHIYNLGPGNDPKLVNKILDPNYLSGISELFANVNQTIQEHGPWAAAWVGEAGGAFNSGGRQVSETFINSFWYLD
  QLGISSKHNTKVYCRQALVGGFYGLLEKETFVPNPDYYSALLWHRLMGKGILGVQTTASEYLRAYVHCSKRRAGITILLINLSKHTTFTVAVSNGVKVVL
  QAESMKRKSFLETIKSKVSWVGNKASDGYLNREEYHLSPKDGDLRSKIMLLNGKPLVPTATGDIPKLEPVRHGVKSPVYINPLSISFIVLPTF
Full Sequence
Protein Sequence     Length: 540     Download
MGFNVVVFLS CLLLLPPVTF GSNMERTTLV IDGSRRIAET DENFICATLD WWPPEKCNYD    60
QCPWGYASLI NLNLASPLLA KAIQAFRTLR IRIGGSLQDQ VIYDVGDLKT PCTQFKKTDD    120
GLFGFSEGCL YMKRWDEVNH FFNATGAIVT FGLNALHGRN KLNGTAWGGD WDHTNTQDFM    180
NYTVSKGYAI DSWEFGNELS GSGIWASVSV ELYGKDLIVL KNVIKNVYKN SRTKPLVVAP    240
GGFFEEQWYS ELLRLSGPGV LDVLTHHIYN LGPGNDPKLV NKILDPNYLS GISELFANVN    300
QTIQEHGPWA AAWVGEAGGA FNSGGRQVSE TFINSFWYLD QLGISSKHNT KVYCRQALVG    360
GFYGLLEKET FVPNPDYYSA LLWHRLMGKG ILGVQTTASE YLRAYVHCSK RRAGITILLI    420
NLSKHTTFTV AVSNGVKVVL QAESMKRKSF LETIKSKVSW VGNKASDGYL NREEYHLSPK    480
DGDLRSKIML LNGKPLVPTA TGDIPKLEPV RHGVKSPVYI NPLSISFIVL PTFDAPACS*    540
                                                                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03662Glyco_hydro_79n024343320+
Gene Ontology
GO TermDescription
GO:0004566beta-glucuronidase activity
GO:0012505endomembrane system
GO:0016020membrane
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB08480.10245391516unnamed protein product [Arabidopsis thaliana]
EMBLCAB62595.10205391521putative protein [Arabidopsis thaliana]
RefSeqNP_196400.2015391543AtGUS2 (Arabidopsis thaliana glucuronidase 2); beta-glucuronidase
RefSeqNP_200933.2015391539AtGUS1 (Arabidopsis thaliana glucuronidase 1); beta-glucuronidase
RefSeqXP_002514696.101753915539Heparanase-2, putative [Ricinus communis]
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB2605322302254540
ES904561228182450
HO7970313711745390
JZ12338829612960
GO873410329343590
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00009.1Aquca_002_00770.2Aquca_002_00771.1Aquca_002_00770.1Aquca_002_00770.3
Aquca_002_00771.4Aquca_002_00771.3Aquca_002_00770.4Aquca_002_00771.2.202.436Aquca_002_00771.2.202.436
Aquca_002_00771.2.40.206Aquca_002_00771.2.40.206
Arabidopsis lyrata493582496280350042497509
Arabidopsis thalianaAT5G34940.2AT5G07830.1AT5G61250.2AT5G34940.3AT5G34940.1
Brachypodium distachyonBradi1g47760.1Bradi3g54370.1Bradi1g70300.1Bradi4g03680.1Bradi4g03680.2
Bradi1g70300.3
Brassica rapaBra038945Bra012974Bra009310
Carica papayaevm.model.supercontig_277.3evm.model.supercontig_187.5evm.model.supercontig_51.106evm.model.supercontig_51.104evm.model.supercontig_51.103
Capsella rubellaCarubv10004531mCarubv10028123mCarubv10002679m
Citrus clementinaCiclev10007919mCiclev10010401mCiclev10019606mCiclev10019304mCiclev10033641m
Citrus sinensisorange1.1g008951morange1.1g037212morange1.1g008762morange1.1g009131morange1.1g009122m
orange1.1g009113morange1.1g009102morange1.1g008834morange1.1g041499morange1.1g013838m
orange1.1g014399morange1.1g019695m
Cucumis sativusCucsa.113020.5Cucsa.113020.2Cucsa.113020.1Cucsa.132500.1Cucsa.198040.1
Cucsa.284640.1Cucsa.201230.1Cucsa.034470.1Cucsa.252720.2Cucsa.252720.1
Eucalyptus grandisEucgr.C02742.1Eucgr.K02497.1Eucgr.B00567.2Eucgr.B00567.1Eucgr.G02460.1
Eucgr.C04395.1Eucgr.B03174.1Eucgr.C02742.2Eucgr.C04395.2Eucgr.C02741.1
Eucgr.C02740.1
Fragaria vescamrna30784.1-v1.0-hybridmrna26075.1-v1.0-hybridmrna11598.1-v1.0-hybridmrna11600.1-v1.0-hybrid
Glycine maxGlyma09g11990.2Glyma09g11990.1Glyma15g23550.1Glyma13g23190.1Glyma17g11670.1
Glyma04g32745.2Glyma04g32745.1Glyma05g00663.1Glyma17g08444.1Glyma06g21551.2
Glyma06g21551.1Glyma02g12760.1Glyma02g12740.1Glyma09g11990.3Glyma05g00663.2
Glyma02g12740.2Glyma06g40075.1Glyma10g27494.1
Gossypium raimondiiGorai.004G108900.2Gorai.004G108900.1Gorai.008G196400.1Gorai.010G059600.1Gorai.006G267500.2
Gorai.006G267500.1Gorai.004G293000.2Gorai.011G285000.1Gorai.011G271100.1Gorai.004G293000.1
Gorai.N016700.1Gorai.011G285200.1Gorai.N009300.1Gorai.010G059600.2Gorai.006G004300.1
Gorai.009G305800.1Gorai.008G196400.2Gorai.006G004400.1Gorai.N021000.1Gorai.006G004500.1
Gorai.010G059600.3Gorai.N009100.1Gorai.006G004200.1Gorai.N009200.1.197.494Gorai.N009200.1.197.494
Gorai.011G284500.1.38.235Gorai.011G284500.1.38.235Gorai.006G021700.1.57.271Gorai.006G021700.1.57.271Gorai.011G284500.1.237.471
Gorai.011G284500.1.237.471Gorai.N009200.1.41.200Gorai.N009200.1.41.200Gorai.011G271700.1Gorai.006G021700.1.269.391
Gorai.006G021700.1.269.391
Linum usitatissimumLus10008823Lus10038109Lus10008038Lus10003468Lus10015737
Lus10021652Lus10034707Lus10001923Lus10004664Lus10036963
Lus10037110Lus10037109Lus10036962Lus10001952
Malus domesticaMDP0000088659MDP0000189628MDP0000242071MDP0000199066MDP0000252327
MDP0000248683
Manihot esculentacassava4.1_032464mcassava4.1_005011mcassava4.1_031502mcassava4.1_005078mcassava4.1_005072m
cassava4.1_004963mcassava4.1_021602mcassava4.1_008768m
Medicago truncatulaMedtr4g116070.1Medtr5g043710.1Medtr4g116040.1Medtr8g091920.1
Mimulus guttatusmgv1a026019mmgv1a004063mmgv1a026758mmgv1a004017mmgv1a004194m
mgv1a008019mmgv1a008017mmgv1a025097mmgv1a011158m
Oryza sativaLOC_Os06g08090.2LOC_Os06g08090.1LOC_Os02g55870.1LOC_Os12g38920.2LOC_Os12g38920.1
LOC_Os03g11320.2LOC_Os03g11320.1LOC_Os07g40740.1
Panicum virgatumPavirv00018673mPavirv00048771mPavirv00008589mPavirv00009033mPavirv00009032m
Pavirv00012019mPavirv00030038mPavirv00060468mPavirv00035109mPavirv00018674m
Pavirv00033639m
Physcomitrella patensPp1s118_67V6.1Pp1s90_137V6.1Pp1s121_77V6.1Pp1s181_80V6.1
Phaseolus vulgarisPhvul.009G212400.1Phvul.003G186600.2Phvul.003G186600.1Phvul.003G171800.1Phvul.002G081000.1
Phvul.003G171800.2Phvul.002G087100.3Phvul.002G087100.2Phvul.002G087100.1
Picea abiesMA_77698g0010MA_10433885g0020MA_93036g0020MA_854085g0010MA_71853g0010
MA_93036g0010.60.248MA_93036g0010.60.248MA_343625g0010MA_269826g0010MA_10433885g0010
MA_93036g0010.317.479MA_93036g0010.317.479
Populus trichocarpaPotri.018G121500.1Potri.018G024200.1Potri.006G062200.2Potri.006G062200.1Potri.010G160800.2
Potri.010G160800.1Potri.010G160800.3Potri.015G049100.4Potri.015G049100.3Potri.015G049100.2
Potri.015G049100.1Potri.018G121500.3Potri.018G121500.2Potri.015G049100.5Potri.010G160800.4
Potri.015G049100.6
Prunus persicappa003883mppa019445mppa003804mppa003813mppa025624m
Ricinus communis29848.m00459029720.m00013730138.m00401530174.m00914230174.m009143
Setaria italicaSi016855mSi006147mSi035072mSi035071mSi021698m
Selaginella moellendorffii10593113310032458
Sorghum bicolorSb04g036200.1Sb10g005260.1Sb01g043180.1Sb08g019250.1
Thellungiella halophilaThhalv10013186mThhalv10003960mThhalv10003449m
Vitis viniferaGSVIVT01012851001GSVIVT01007918001GSVIVT01012184001GSVIVT01035950001.36.452GSVIVT01035950001.36.452
GSVIVT01035950001.521.878GSVIVT01035950001.521.878
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)