y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis thaliana
Cazyme IDAT5G67540.2
FamilyGH43
Protein PropertiesLength: 472 Molecular Weight: 53786.5 Isoelectric Point: 9.2611
ChromosomeChromosome/Scaffold: 5 Start: 26944028 End: 26946365
Descriptionexpressed protein
View CDS
External Links
TAIR
Geo Profiles
ATTED-II
NCBI Taxonomy
Plaza
SIGnAL
CAZyDB
Entrez Gene
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH431693944.5e-34
  VKSNTYYWYGEYKDGPTYHAHKKGPARVDIIGVGCYSSKDLWTWKNEGIVLGAEETNKTHDLHKSNVLERPKVIYNEKTEKYVMWMHIDDANYTKASVGV
  AISNSPTGPFEYLYSKRPHGFDSRDMTVFKDDDGVAYLIYSSEVNSVLHIGPLTEDYLDVTPVMKRVMVGQHREAPAIFKHQNIYYMVTSWCTGWAPNEA
  LAHAAESIMGPWEKLGNPCIGGNKVF
Full Sequence
Protein Sequence     Length: 472     Download
MKKNNKYNKK STSLHCNDAG GCRYSLLTIV WTVVGFFLVA HLISLYSRKD NNIHQQVSSD    60
QLQVVHHLAH PIVRELIRVE EEVLRMPPPR KRSPRTSKRR SRKPIPLVEE FLDDKSPIRH    120
LFFPGIKTAA FGPTKDMGNE TSYYFPGKIW MDTQGNPIQA HGGGILLDVK SNTYYWYGEY    180
KDGPTYHAHK KGPARVDIIG VGCYSSKDLW TWKNEGIVLG AEETNKTHDL HKSNVLERPK    240
VIYNEKTEKY VMWMHIDDAN YTKASVGVAI SNSPTGPFEY LYSKRPHGFD SRDMTVFKDD    300
DGVAYLIYSS EVNSVLHIGP LTEDYLDVTP VMKRVMVGQH REAPAIFKHQ NIYYMVTSWC    360
TGWAPNEALA HAAESIMGPW EKLGNPCIGG NKVFRLTTFF AQSTYVIPLP GVPGAFIFMA    420
DRWNPADLRD SRYVWLPLVI GGPADQPLEF NFGFPSWSRV SIYWHSKWRL P*            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd09004GH43_bXyl2.0e-19202385194+
cd08990GH43_AXH_like1.0e-19203381193+
cd08978GH_F4.0e-57161440291+
cd08985GH43_63.0e-129158440284+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005575cellular_component
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI33680.106647124427unnamed protein product [Vitis vinifera]
RefSeqNP_190557.1054716458glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqNP_201555.201947114466glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqNP_975008.101147111471glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqXP_002525277.10147132492beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F012543818328A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3vt2_E012543818328A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3vt2_D012543818328A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3vt2_C012543818328A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3vt2_B012543818328A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8561533271444700
GO3743623451334710
EY7037302951554490
EG5174952431223640
EG517495551131670.009
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi1g71160.1Bradi2g50980.1
Brassica rapaBra024441Bra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1Gorai.003G030500.2
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2LOC_Os01g65720.1
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.003G234900.1Phvul.002G010600.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny