y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra001433
FamilyGH16
Protein PropertiesLength: 285 Molecular Weight: 31942 Isoelectric Point: 8.537
ChromosomeChromosome/Scaffold: 03 Start: 16356668 End: 16358718
Descriptionxyloglucan endotransglucosylase/hydrolase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16392022.4e-28
  LKLNQGEVQLSMDKSAGSAFESKHKFGSGFFQMRIKLPPKDTAGVVTAFYLTSKGDTHDEVDFEFLGNRDGKPIQIQTNVFNNGQGNREQKFVLWFDPST
  DFHTYGILWNPYQIVFYVDKIPIRIFKNNKKYGVGYPSKPMTVIASLWNGEGWATDGGKAKINW
Full Sequence
Protein Sequence     Length: 285     Download
MFSILDFVLV LLVIATVDAS VPGGGGFDEN YVVTWGNVLK LNQGEVQLSM DKSAGSAFES    60
KHKFGSGFFQ MRIKLPPKDT AGVVTAFYLT SKGDTHDEVD FEFLGNRDGK PIQIQTNVFN    120
NGQGNREQKF VLWFDPSTDF HTYGILWNPY QIVFYVDKIP IRIFKNNKKY GVGYPSKPMT    180
VIASLWNGEG WATDGGKAKI NWSYAPFKAN FQSFSDSGCH ADGGNINAEA CGSTTYYWNT    240
IQYSRLSANE TTAFKNVRAK YMKYDYCSDK RRFPVPPTEC RLNQ*                    300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00413Glyco_hydrolase_161.0e-2355196151+
cd02183GH16_fungal_CRH1_transglycosylase7.0e-2724213206+
pfam00722Glyco_hydro_162.0e-7327204181+
PLN03161PLN031612.0e-881280286+
cd02176GH16_XET9.0e-14522280264+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_189141.1042806289XTH3 (XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 3); hydrolase, acting on glycosyl bonds / xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana]
RefSeqNP_193044.2022834291xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana]
RefSeqNP_193045.1052848292xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana]
Swiss-ProtQ9SV61022837294XTH1_ARATH RecName: Full=Putative xyloglucan endotransglucosylase/hydrolase protein 1; Short=At-XTH1; Short=XTH-1; Flags: Precursor
RefSeqXP_002521076.1022803283Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B02228412276A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB1un1_A02228412276A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB1umz_B02228412276A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A02228412276A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2vh9_B042805290A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE533496251352850
EE53341021612160
EE458623204712740
EE518890192942850
EE51702419111910
Orthologous Group
SpeciesID
Arabidopsis lyrata884593899104485216359038359039
883627883616
Arabidopsis thalianaAT4G13090.1AT3G25050.1AT3G48580.1AT4G13080.1
Brachypodium distachyonBradi1g44777.1Bradi1g71937.1
Brassica rapaBra001434Bra015093
Carica papayaevm.model.supercontig_8.136
Capsella rubellaCarubv10016385mCarubv10005358mCarubv10006916mCarubv10006944mCarubv10018461m
Citrus clementinaCiclev10033360mCiclev10023425m
Citrus sinensisorange1.1g042925morange1.1g041460m
Cucumis sativusCucsa.067150.1
Eucalyptus grandisEucgr.H00787.1Eucgr.H00788.1Eucgr.K02717.1Eucgr.K02715.1
Fragaria vescamrna17598.1-v1.0-hybrid
Glycine maxGlyma18g35720.2Glyma18g35720.1Glyma08g46450.1
Gossypium raimondiiGorai.007G155700.1Gorai.004G226400.1
Linum usitatissimumLus10032879Lus10025919Lus10038182Lus10022784Lus10011845
Lus10022782
Malus domesticaMDP0000311020
Manihot esculentacassava4.1_032567m
Medicago truncatulaMedtr2g049030.1Medtr2g049130.1
Mimulus guttatusmgv1a010995mmgv1a011712mmgv1a020473mmgv1a011649mmgv1a025665m
mgv1a019895mmgv1a020281mmgv1a021895mmgv1a011700mmgv1a010970m
Oryza sativaLOC_Os06g13040.1
Panicum virgatumPavirv00069636mPavirv00044296mPavirv00046059m
Phaseolus vulgarisPhvul.008G129900.1Phvul.008G129100.1
Picea abiesMA_300041g0010MA_10083496g0010MA_254951g0010
Populus trichocarpaPotri.002G244200.1
Prunus persicappa019741mppa027154m
Ricinus communis30204.m00174129904.m002924
Setaria italicaSi007117mSi006999m
Selaginella moellendorffii403283
Sorghum bicolorSb10g008540.1Sb10g008550.1
Thellungiella halophilaThhalv10002629mThhalv10010620mThhalv10026812m
Vitis viniferaGSVIVT01003280001GSVIVT01004746001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny