y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra001576
FamilyGT31
Protein PropertiesLength: 343 Molecular Weight: 38505.5 Isoelectric Point: 9.1177
ChromosomeChromosome/Scaffold: 03 Start: 17154991 End: 17157179
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT31982900
  RRRALRNTWMPSDPQGLRRLEESTGLAIRFIIGKTKDEAKMAELRREIAEYDDFILLDIEEEYSKLPYKTLAFFKAAYALYDSAFYVKADDDIYLRPDRL
  SLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLADLLGQEYFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHEN
Full Sequence
Protein Sequence     Length: 343     Download
MPSSPRLKLF HARPSRRPTS LIVITSIAIG LFGFLFGLSA IIFPGIRLSS RTCLTNSPPK    60
TVRIVWDVAG NRNANGGVKR HKVMGFVGIQ TGFSSAGRRR ALRNTWMPSD PQGLRRLEES    120
TGLAIRFIIG KTKDEAKMAE LRREIAEYDD FILLDIEEEY SKLPYKTLAF FKAAYALYDS    180
AFYVKADDDI YLRPDRLSLL LAKERSHSQT YLGCLKKGPV FTDPKLKWYE PLADLLGQEY    240
FLHAYGPIYA LSADVVTSLV ALKNNSFRMF SNEDVTIGAW MLAMNVNHEN HKTLCEPECS    300
PSSIAVWDIP KCSGLCNPEK RMLELHKKES CSKSPTLPSE DE*                      360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03133PLN031338.0e-1686291222+
PLN03193PLN031932.0e-4980328269+
pfam01762Galactosyl_T3.0e-5098290201+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF69535.1043423353AC008007_10 F12M16.19 [Arabidopsis thaliana]
RefSeqNP_175736.2043423345galactosyltransferase family protein [Arabidopsis thaliana]
RefSeqNP_188114.1013421343galactosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002317466.10243411326predicted protein [Populus trichocarpa]
RefSeqXP_002330737.1013411351predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV538084265793430
DK50168927582770
DR935688260823410
DY27237133113140
DY272371253103344.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_081_00004.1
Arabidopsis lyrata474455901308897766
Arabidopsis thalianaAT1G53290.1AT3G14960.1AT2G26100.1
Brachypodium distachyonBradi2g33090.1Bradi1g48880.1
Brassica rapaBra027291Bra038114Bra034289
Carica papayaevm.model.supercontig_97.96
Capsella rubellaCarubv10023358mCarubv10009980mCarubv10009620mCarubv10014091m
Citrus clementinaCiclev10020877mCiclev10008876mCiclev10010334m
Citrus sinensisorange1.1g018669morange1.1g018637morange1.1g020201m
Cucumis sativusCucsa.122670.1Cucsa.122670.2
Eucalyptus grandisEucgr.F03260.2Eucgr.F03260.1Eucgr.F03260.5Eucgr.F01224.1Eucgr.F03260.3
Eucgr.F03260.4Eucgr.C03050.1
Fragaria vescamrna27228.1-v1.0-hybridmrna02689.1-v1.0-hybrid
Glycine maxGlyma13g34630.1Glyma06g33880.1Glyma20g09170.1
Gossypium raimondiiGorai.009G368400.1Gorai.009G368400.2Gorai.010G100900.1Gorai.002G062000.1
Linum usitatissimumLus10014451Lus10023955Lus10013683
Malus domesticaMDP0000323739MDP0000306900MDP0000237443
Manihot esculentacassava4.1_010336mcassava4.1_011023m
Mimulus guttatusmgv1a009062m
Oryza sativaLOC_Os06g06280.1LOC_Os06g06280.2LOC_Os05g11060.1LOC_Os05g11060.2
Panicum virgatumPavirv00018938mPavirv00043119mPavirv00019539mPavirv00061117mPavirv00048022m
Pavirv00036678m
Physcomitrella patensPp1s34_219V6.1Pp1s65_64V6.1
Phaseolus vulgarisPhvul.005G067100.1Phvul.011G159800.1
Picea abiesMA_10428560g0010MA_10426473g0010
Populus trichocarpaPotri.006G228900.3Potri.006G228900.4Potri.006G228900.1Potri.006G228900.2Potri.011G111700.2
Potri.011G111700.1Potri.001G392700.1
Prunus persicappa007915mppa007437m
Ricinus communis30150.m00048629794.m003321
Setaria italicaSi022377mSi006727m
Selaginella moellendorffii5630166328
Sorghum bicolorSb09g006190.1Sb10g003920.1
Thellungiella halophilaThhalv10021058mThhalv10002018mThhalv10011624m
Vitis viniferaGSVIVT01035404001GSVIVT01014218001
Volvox carteriVocar20001878m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)