y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra005140
FamilyAA1
Protein PropertiesLength: 577 Molecular Weight: 63421 Isoelectric Point: 9.8274
ChromosomeChromosome/Scaffold: 05 Start: 3679277 End: 3682262
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA12695640
  VKPFKTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTT
  IDHHLFFTVGLGLNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQD
  TGVIAPENHPIHLHGFNFFEVGRGLGNFNAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQ
AA1252690
  MVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTL
  WWHAHILWLRATVHGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLAPNVSDAHMINGHSGPVNNCPSQGYKLSVTNGKTYLLRLV
  NAALNEELFFKVAGHLFTVVEVDAVFVKPFKTATVLIAPGQTTNV
Full Sequence
Protein Sequence     Length: 577     Download
MKSHMVWFLF LVSFLSMFPA PSESMVRHYK FNVVMKNITR LCSSKPTVTV NGRYPGPTIY    60
AREDDTLLIK VVNHVKYNVS IHWHGVRQVR TGWADGPAYI TQCPLQPGQV YTYNYTLTGQ    120
RGTLWWHAHI LWLRATVHGA IVILPKRGVP YPFPKPDHEK VIVLAEWWKS DTENVINEAL    180
KSGLAPNVSD AHMINGHSGP VNNCPSQGYK LSVTNGKTYL LRLVNAALNE ELFFKVAGHL    240
FTVVEVDAVF VKPFKTATVL IAPGQTTNVK PFKTDTVLIA PGQTTNVLLT TSKSAGKYLV    300
TASPFMDSPI AVDNVTATAT VHYSGTLSSS PTTLTLPPPQ NATTIANNFT NSLRSLNSKK    360
YPALVPTTID HHLFFTVGLG LNPCPTCKAG NGSRVVASIN NVTFTMPKTA LLPAHYFNIS    420
GVFTTDFPKN PPHVFNYSGG SVTNMATETG TRLYKLPYNA TVQLVLQDTG VIAPENHPIH    480
LHGFNFFEVG RGLGNFNAKK DPSNFNLVDP VERNTIGVPS GGWVVIRFRA DNPGVWFMHC    540
HLEVHTTWGL KMAFLVENGK GPNQSILPPP KDLPKC*                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_32.0e-4932148119+
PLN02191PLN021912.0e-576566601+
PLN02604PLN026045.0e-794554575+
TIGR03388ascorbase4.0e-8026554563+
TIGR03389laccase026576555+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC49536.1095767557diphenol oxidase [Nicotiana tabacum]
RefSeqNP_565881.1015761558IRX12 (IRREGULAR XYLEM 12); laccase [Arabidopsis thaliana]
RefSeqXP_002322961.1085766557laccase 1a [Populus trichocarpa]
RefSeqXP_002322962.1075765557laccase 1b [Populus trichocarpa]
RefSeqXP_002520425.1075766556laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0245541521A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1asq_A0245541521A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1asp_B0245541521A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1asp_A0245541521A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1aso_B0245541521A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797675513705770
ES90665429412940
DY2947124181115220
DW494893301263250
HO802983299173140
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00935.1
Brassica rapaBra005140.269.564Bra005140.269.564
Carica papayaevm.model.supercontig_19.218evm.model.supercontig_139.15.299.495evm.model.supercontig_169.17.281.510evm.model.supercontig_169.17.281.510evm.model.supercontig_139.15.299.495
Citrus sinensisorange1.1g047904morange1.1g008592m.269.548orange1.1g008592m.269.548
Glycine maxGlyma13g41310.1
Gossypium raimondiiGorai.009G103600.1.261.496Gorai.009G103600.1.261.496
Linum usitatissimumLus10013800Lus10004975
Malus domesticaMDP0000127409
Panicum virgatumPavirv00032912mPavirv00002681mPavirv00055389m
Phaseolus vulgarisPhvul.008G100600.1.286.504Phvul.008G100600.1.286.504
Picea abiesMA_502044g0010MA_9147880g0010MA_115430g0010MA_10430876g0010MA_10053838g0010
MA_9198822g0010MA_14240g0010
Prunus persicappa018465mppa017222mppa022262m
Sorghum bicolorSb03g028920.1
Vitis viniferaGSVIVT01034140001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny