y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra005722
FamilyGT59
Protein PropertiesLength: 509 Molecular Weight: 58022.3 Isoelectric Point: 9.1866
ChromosomeChromosome/Scaffold: 03 Start: 285898 End: 288097
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59244600
  IVPEPYMDEIFHVPQAQQYCKGNLRSWDPMITTPPGLYYLSLAHVASLFPGMLLVGATSQSFSEACSTSVLRSTNAVFAVLCGVLVFEIIRFLGPNLSDA
  KATLIALVMSLYPLHWFFTFLYYTDVASLTAFLAMYLACLRKRYFLSAFFGALAICTRQTNVVWMLFVACSGVLDFTLDSPRQKEKEKVDQDSYHQSIGR
  KEATPRSNLRKRKPDNSTLDPFDRAKSFSSTEDTSGLVYDVYAVISTCWSMKWQLLVTFSPFIVVVVAFGIFIIWNGGIVLGAKEDHVVSPHFAQIMYFS
  LVSALFTAPLHFSVGQLRNLLQELRQNRPLSLLLTLVALVAGLASVHFFSLAHPYLLADNRHYPFYLWRKIINAHWLMKYMLVPVYVYSWFSILSLLEKS
  RRKIWVLVYFLATCAVLVPTPLIEFRYYTIPFYIFML
Full Sequence
Protein Sequence     Length: 509     Download
MGKIAVAAIT SLWVIPMSII VNHIVPEPYM DEIFHVPQAQ QYCKGNLRSW DPMITTPPGL    60
YYLSLAHVAS LFPGMLLVGA TSQSFSEACS TSVLRSTNAV FAVLCGVLVF EIIRFLGPNL    120
SDAKATLIAL VMSLYPLHWF FTFLYYTDVA SLTAFLAMYL ACLRKRYFLS AFFGALAICT    180
RQTNVVWMLF VACSGVLDFT LDSPRQKEKE KVDQDSYHQS IGRKEATPRS NLRKRKPDNS    240
TLDPFDRAKS FSSTEDTSGL VYDVYAVIST CWSMKWQLLV TFSPFIVVVV AFGIFIIWNG    300
GIVLGAKEDH VVSPHFAQIM YFSLVSALFT APLHFSVGQL RNLLQELRQN RPLSLLLTLV    360
ALVAGLASVH FFSLAHPYLL ADNRHYPFYL WRKIINAHWL MKYMLVPVYV YSWFSILSLL    420
EKSRRKIWVL VYFLATCAVL VPTPLIEFRY YTIPFYIFML HSCVRNSGWA TWLLTGTVFV    480
CVNVFTMGMF LFRTFKWSHE DGVQRFIW*                                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG102.0e-12422460440+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.1015081498putative protein [Arabidopsis thaliana]
EMBLCAN64153.102750827517hypothetical protein [Vitis vinifera]
RefSeqNP_195861.2015081509DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_002270322.102750827510PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509451.102737227376conserved hypothetical protein [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5472EC-2.4.1.256Dol-P-Glc:Glc2Man9GlcNAc2-PP-Dol α-1,2-glucosyltransferase
Transmembrane Domains
StartEnd
527
5880
93115
141163
276298
318340
352374
394416
428450
470492
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DK49988622112210
DK49997623412340
DK49808521412140
EV53507220912070
EV5398352122985090
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny