y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra006514
FamilyGT66
Protein PropertiesLength: 779 Molecular Weight: 86191.6 Isoelectric Point: 9.2677
ChromosomeChromosome/Scaffold: 03 Start: 3862703 End: 3867820
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66237240
  LSALILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNAINIPLSVETVCV
  FTAPVFSAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVCSWGGYTFIIN
  LIPMHVLLCIVTGRYSPRLYIAYAPLVVLGTLLAALVPVVGFNAVLTSEHFASFLVFIIIHVVALVYYIKGILTPKMFKVAVTLVVSIGLVVCLIVVAVL
  VALVASSPTGGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFSPLSDASSFVVLYIVMSVYFSGVMVRLMLVLAPAA
  CIMSGIALSQAFDVFTGSIKYQLSSKSKDDAEDNTSTKNAPKDDASSGKADKGEEVAKERLSKKGKKKEREPAEKPSVKSKIVKKKALVLPLEASIVALL
  LLIMLGAFYVIHCVWAAAEAYSAPSIVLTSQSHDGLHVFDDFRESYAWLSHNTDVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE
  KAAWEIFNSLDVKYVLVVFGGVIGYPSDDINKFLWMVRIGGGEFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLCYYRFVETDGKGYDRVRRTEIGKK
  HF
Full Sequence
Protein Sequence     Length: 779     Download
MAAVESLPPG TPSAMRNAFG TVLSALILVL IGVLAFSIRL FSVIKYESVI HEFDPYFNYR    60
VTQFLSKNGI YEFWNWFDDR TWYPLGRVIG GTVYPGLTLT AGTIWWVLNA INIPLSVETV    120
CVFTAPVFSA FASWATYLLT KEVKGSGAGL AAAALLAMVP SYISRSVAGS YDNEAVAIFA    180
LIFTFYLYIK TLNTGSLFYA TLNAIAYFYM VCSWGGYTFI INLIPMHVLL CIVTGRYSPR    240
LYIAYAPLVV LGTLLAALVP VVGFNAVLTS EHFASFLVFI IIHVVALVYY IKGILTPKMF    300
KVAVTLVVSI GLVVCLIVVA VLVALVASSP TGGWSGRSLS LLDPTYASKY IPIIASVSEH    360
QPPTWPSYFM DINVLAFLVP AGIIACFSPL SDASSFVVLY IVMSVYFSGV MVRLMLVLAP    420
AACIMSGIAL SQAFDVFTGS IKYQLSSKSK DDAEDNTSTK NAPKDDASSG KADKGEEVAK    480
ERLSKKGKKK EREPAEKPSV KSKIVKKKAL VLPLEASIVA LLLLIMLGAF YVIHCVWAAA    540
EAYSAPSIVL TSQSHDGLHV FDDFRESYAW LSHNTDVDDK VASWWDYGYQ TTAMANRTVI    600
VDNNTWNNTH IATVGTAMSS PEKAAWEIFN SLDVKYVLVV FGGVIGYPSD DINKFLWMVR    660
IGGGEFPHIK EADYLRDGQY RIDSEATPTM LNCLMYKLCY YRFVETDGKG YDRVRRTEIG    720
KKHFKLTHFE EVFTSHHWMV RIYKLKPQKN RIRGRVKKLK QKTSSGVSSK SVKKNPWM*     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT30.003516639144+
TIGR04154archaeo_STT34.0e-1126230229+
COG1287COG12871.0e-6113753783+
pfam02516STT36.0e-11722705711+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK91413.1017781779AT5g19690/T29J13_110 [Arabidopsis thaliana]
GenBankEEC79544.10147783471119hypothetical protein OsI_20658 [Oryza sativa Indica Group]
RefSeqNP_001056068.101377814787Os05g0519900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_568380.1017781779STT3A (STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIKE A); oligosaccharyl transferase [Arabidopsis thaliana]
RefSeqXP_002514244.104577743778oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A053477620267A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.00085636756125A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.00085636756125A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.00085636756125A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
2143
86108
115137
147169
176198
213235
242264
274291
304326
368390
395417
516538
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7788675322237540
HO4763975542137510
HO7969143564007540
HO778867851412253e-40
HO778867291171453e-40
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)