y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra009448
FamilyGT64
Protein PropertiesLength: 764 Molecular Weight: 86005 Isoelectric Point: 8.8322
ChromosomeChromosome/Scaffold: 10 Start: 16684412 End: 16687191
Descriptionglycosyltransferase family protein 47
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT645167500
  FTLATMTYDARLWNLKMYVKHYSRCASVKEIVVIWNKGHPPDPTELDSAVPVRIRVEKRNSLNNRFSIDPLITTRAVLELDDDIMMSCDEIEKGFRVWRE
  HPERLVGFYPRYVDQSMTYNAEKFARSHKGYNMILTGAAFMDVGFAFGLYQSERARLGREFVDEQFNCEDVLLNFLYANASGSAKAVEYVRPSALVLDTS
  KFSGVAISGNTDQHYRKRSECVRRFSELYGSLSDR
Full Sequence
Protein Sequence     Length: 764     Download
MMEETAEIVG KSSLHKNVHN HNRYRYLSSY GGSSSVRRFL FFVSCFGLYA LVALTYAWLA    60
FPPHIGRTYH VSSSSLGCRE DNEGSWSVGV YYGDSPFTLK PIETVNVWRN ESAAWPVANP    120
VLTCASLTNS GFPSNFIADP FLYVQGDTLY LFFENKNPIT LQGDIGVAES TDKGATWKPL    180
GIALDEPWHL SFPFVFNFNG QIYMMPESSQ IGELRLYRAI NFPLTWKLEK VILQKPLVDT    240
TIIHHQGNYW LLGSDHSSFG AKKNGQLEIW YSTTPLGPWK QHKNNPIYNG KRNVGARNGG    300
RGFLHDGNLY RVGQDCGENY GKRIRMFKIE TLSKEEYIEV EVPFDLEVPR KGKNSWNGLR    360
HHHFEVRQLS SGGYVGLVDG DRVTSGDLFH RVLLGYTSLA GAITLVVLLG FLLGVVNCIV    420
PSTWCMNYYA GKRTDALFNL ETDGFFSGKL RRMCSRLNRV PPFLRGLVKP SSALGRLSLA    480
LILLVGVVLS CLGVSYIYGG SGAVQPYTFK GHASQFTLAT MTYDARLWNL KMYVKHYSRC    540
ASVKEIVVIW NKGHPPDPTE LDSAVPVRIR VEKRNSLNNR FSIDPLITTR AVLELDDDIM    600
MSCDEIEKGF RVWREHPERL VGFYPRYVDQ SMTYNAEKFA RSHKGYNMIL TGAAFMDVGF    660
AFGLYQSERA RLGREFVDEQ FNCEDVLLNF LYANASGSAK AVEYVRPSAL VLDTSKFSGV    720
AISGNTDQHY RKRSECVRRF SELYGSLSDR RGEFGGRKDG GDL*                     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08978GH_F0.0007105299211+
pfam09258Glyco_transf_642.0e-78516754247+
Gene Ontology
GO TermDescription
GO:0016758transferase activity, transferring hexosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85556.1027631764putative protein [Arabidopsis thaliana]
RefSeqNP_196070.2017631765glycosyltransferase family protein 47 [Arabidopsis thaliana]
RefSeqXP_002262646.107476369756PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315348.107176395847predicted protein [Populus trichocarpa]
RefSeqXP_002532924.107476317704transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1on8_B2e-2651074724270A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1on8_A2e-2651074724270A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1on6_B2e-2651074724270A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1on6_A2e-2651074724270A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1omz_B2e-2651074724270A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
Transmembrane Domains
StartEnd
3961
398420
477499
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY0055272305197480
HO8114584273397640
EV0202842504647130
EE4645302504496980
EE43849922712270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00173.1Aquca_013_00497.1Aquca_004_00315.3Aquca_004_00315.1Aquca_004_00315.4
Aquca_004_00315.2Aquca_004_00315.5Aquca_009_01030.2Aquca_009_01030.1Aquca_019_00086.1
Aquca_009_01029.1
Arabidopsis lyrata340192908336
Arabidopsis thalianaAT1G80290.2AT1G80290.1AT3G55830.1AT5G04500.1
Brachypodium distachyonBradi3g40395.1Bradi1g34550.1Bradi1g12290.1Bradi1g34550.2Bradi2g18300.1
Brassica rapaBra008483Bra007194Bra028787
Carica papayaevm.model.supercontig_488.3evm.model.supercontig_19.204evm.model.supercontig_4.178evm.model.supercontig_128.65
Capsella rubellaCarubv10016140mCarubv10017597mCarubv10003280m
Chlamydomonas reinhardtiiCre12.g508700.t1.2
Citrus clementinaCiclev10010680mCiclev10032067mCiclev10030719m
Citrus sinensisorange1.1g020041morange1.1g045656m
Cucumis sativusCucsa.311230.1Cucsa.368680.1Cucsa.308870.2Cucsa.308870.1
Eucalyptus grandisEucgr.C04240.1Eucgr.G03038.1Eucgr.K00135.1Eucgr.G02723.2Eucgr.G02723.1
Eucgr.K00135.2
Fragaria vescamrna08756.1-v1.0-hybridmrna20928.1-v1.0-hybridmrna09156.1-v1.0-hybridmrna21215.1-v1.0-hybrid
Glycine maxGlyma15g03130.1Glyma14g19550.1Glyma14g06670.1Glyma02g42230.1Glyma14g06670.2
Glyma09g27660.1Glyma16g32650.1Glyma09g27660.2Glyma10g34440.2Glyma20g33120.3
Glyma20g33120.2Glyma14g06670.3
Gossypium raimondiiGorai.008G132700.3Gorai.008G132700.2Gorai.008G132700.1Gorai.012G075900.1Gorai.009G307300.1
Gorai.012G075900.2
Linum usitatissimumLus10020174Lus10040216Lus10028274Lus10031680Lus10037920
Lus10038646Lus10027392
Malus domesticaMDP0000318911MDP0000177948MDP0000292999MDP0000138795MDP0000212600
MDP0000169420
Manihot esculentacassava4.1_010734mcassava4.1_011626mcassava4.1_011602mcassava4.1_011301mcassava4.1_013504m
cassava4.1_010773mcassava4.1_002721mcassava4.1_002024mcassava4.1_012021m
Medicago truncatulaMedtr1g009180.1Medtr5g082110.1
Mimulus guttatusmgv1a026874mmgv1a009961mmgv1a009124mmgv1a023379mmgv1a024929m
Oryza sativaLOC_Os06g49150.1LOC_Os03g48010.1LOC_Os05g46260.1
Panicum virgatumPavirv00045941mPavirv00020436mPavirv00023272mPavirv00018756mPavirv00050841m
Pavirv00045066mPavirv00036974mPavirv00061476m
Physcomitrella patensPp1s242_74V6.1Pp1s87_187V6.1Pp1s242_81V6.1Pp1s72_263V6.1Pp1s117_57V6.1
Phaseolus vulgarisPhvul.002G252600.1Phvul.008G225700.1Phvul.004G124500.1Phvul.007G144400.1
Picea abiesMA_277070g0010MA_140607g0010MA_30471g0010MA_948289g0010MA_8306453g0010
MA_10432291g0040
Populus trichocarpaPotri.006G278400.1Potri.010G191700.7Potri.010G191700.1Potri.008G065800.1Potri.010G191700.2
Potri.010G191700.5Potri.008G028900.2Potri.008G028900.1Potri.010G232700.3Potri.010G232700.2
Potri.010G232700.1Potri.010G191700.4Potri.010G191700.3Potri.010G191700.8Potri.010G191700.6
Prunus persicappa008992mppa008488mppa007532mppa002869m
Ricinus communis29589.m00129129669.m00081027916.m00015930147.m014149
Setaria italicaSi014019mSi006792mSi034429mSi021307m
Selaginella moellendorffii13310340321881258420395139351
Sorghum bicolorSb07g027170.1Sb10g029290.1Sb01g011790.1Sb09g026940.1
Thellungiella halophilaThhalv10000547mThhalv10010522mThhalv10012710m
Vitis viniferaGSVIVT01032860001GSVIVT01034672001
Volvox carteriVocar20000857m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)