y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra015093
FamilyGH16
Protein PropertiesLength: 474 Molecular Weight: 55098 Isoelectric Point: 8.7261
ChromosomeChromosome/Scaffold: 07 Start: 3534467 End: 3538327
Descriptionxyloglucan endotransglucosylase/hydrolase 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH162203936.2e-26
  NYVVKWGQGHISTLHSGKEVDLYMDQSSGAGFESKNIYGSGLFQMRIKVPGGNSGGVVTAFYLTSLGSNHDEIDFEFLGNNDGKPITLQTNIFANGEGNR
  EERFLLWFNPIKHYHTYGILWNPYQIVFYVDNIPIRVYKNQNGVNYPSKPMQVEASLWNGDAWATDGGRTKINY
Full Sequence
Protein Sequence     Length: 474     Download
MNIFRLAGDM THLASVLVLL LKIHTIKSCA GVSLRTQELY AIVFATRYLD IFTSFVSVYN    60
TFMKLVFLGS SFSIVWYMRY HKAVHRTYDR EQDTFRHWFL VLPCLVLALL IHEKFTFLEV    120
LWTFSLYLEA VAILPQLVLL QRTRNIDNLT GQYIFLLGGY RGLYILNWIY RYFTEPHFVH    180
WITWIAGLVQ TLLYADFFYY YFLRFIGGRG VEKYVTFGQN YVVKWGQGHI STLHSGKEVD    240
LYMDQSSGAG FESKNIYGSG LFQMRIKVPG GNSGGVVTAF YLTSLGSNHD EIDFEFLGNN    300
DGKPITLQTN IFANGEGNRE ERFLLWFNPI KHYHTYGILW NPYQIVFYVD NIPIRVYKNQ    360
NGVNYPSKPM QVEASLWNGD AWATDGGRTK INYAYSPFIA HFQDFSGLSG CYIDGRSDNV    420
ATCGSSNYWW NGGKYQRLSG YEQKIYEHIR KKYMNYDYCT DRSKYQSPPR ECY*          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5196ERD21.0e-531191192+
pfam00810ER_lumen_recept1.0e-6228172145+
pfam00722Glyco_hydro_167.0e-70217395181+
PLN03161PLN031614.0e-78217473264+
cd02176GH16_XET3.0e-140212472265+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0006621protein retention in ER lumen
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM64352.1012121212ER lumen retaining receptor (HDEL receptor), putative [Arabidopsis thaliana]
GenBankABK28571.1020447322290unknown [Arabidopsis thaliana]
DDBJBAB01889.1012121214ER lumen protein-retaining receptor-like protein [Arabidopsis thaliana]
RefSeqNP_189141.1020447322290XTH3 (XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 3); hydrolase, acting on glycosyl bonds / xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana]
RefSeqNP_566758.1012121212ER lumen protein retaining receptor, putative / HDEL receptor, putative [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B021547215272X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB1un1_A021547215272X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB1umz_B021547215272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A021547215272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2vh9_B021747243290A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
Transmembrane Domains
StartEnd
1335
5577
94111
121140
153171
181203
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV5296862692064740
EV5711082422334740
DK4979822302064350
EX7667062322434740
EV1526742342414740
Orthologous Group
SpeciesID
Arabidopsis lyrata884593899104485216359038359039
883627883616
Arabidopsis thalianaAT4G13090.1AT3G25050.1AT3G48580.1AT4G13080.1
Brachypodium distachyonBradi1g44777.1Bradi1g71937.1
Brassica rapaBra001434Bra001433
Carica papayaevm.model.supercontig_8.136
Capsella rubellaCarubv10016385mCarubv10005358mCarubv10006916mCarubv10006944mCarubv10018461m
Citrus clementinaCiclev10033360mCiclev10023425m
Citrus sinensisorange1.1g042925morange1.1g041460m
Cucumis sativusCucsa.067150.1
Eucalyptus grandisEucgr.H00787.1Eucgr.H00788.1Eucgr.K02717.1Eucgr.K02715.1
Fragaria vescamrna17598.1-v1.0-hybrid
Glycine maxGlyma18g35720.2Glyma18g35720.1Glyma08g46450.1
Gossypium raimondiiGorai.007G155700.1Gorai.004G226400.1
Linum usitatissimumLus10032879Lus10025919Lus10038182Lus10022784Lus10011845
Lus10022782
Malus domesticaMDP0000311020
Manihot esculentacassava4.1_032567m
Medicago truncatulaMedtr2g049030.1Medtr2g049130.1
Mimulus guttatusmgv1a010995mmgv1a011712mmgv1a020473mmgv1a011649mmgv1a025665m
mgv1a019895mmgv1a020281mmgv1a021895mmgv1a011700mmgv1a010970m
Oryza sativaLOC_Os06g13040.1
Panicum virgatumPavirv00069636mPavirv00044296mPavirv00046059m
Phaseolus vulgarisPhvul.008G129900.1Phvul.008G129100.1
Picea abiesMA_300041g0010MA_10083496g0010MA_254951g0010
Populus trichocarpaPotri.002G244200.1
Prunus persicappa019741mppa027154m
Ricinus communis30204.m00174129904.m002924
Setaria italicaSi007117mSi006999m
Selaginella moellendorffii403283
Sorghum bicolorSb10g008540.1Sb10g008550.1
Thellungiella halophilaThhalv10002629mThhalv10010620mThhalv10026812m
Vitis viniferaGSVIVT01003280001GSVIVT01004746001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny