y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra018056
FamilyCE16
Protein PropertiesLength: 383 Molecular Weight: 42276.8 Isoelectric Point: 7.0826
ChromosomeChromosome/Scaffold: 06 Start: 9861794 End: 9865223
DescriptionGDSL-like Lipase/Acylhydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE16413602.5e-21
  AFGDSFTDTGNSRSGEGPAGFGHLSSFPYGMTYFLRPTNRYSDGRLTIDFVAQSMNLPFLPPYLSLRSTNGSKGTAADSYGVNFAVSGATVIEHSFFSEN
  NLTLDMTPQSIETELGWFEKYLETLETRDKVSLFNDSLFWIGEIGVNDYAYTVGSAVSSDTIRELSISTHTRFLETLLNKGVRYMLVQGHPATGCLTLTM
  TLAAQDDRDNLGCVKSVNNQSYTHNLALQSKLEELRIKYPNATIVYADYWNAYRKVIKNPSKYGISEKFKACCGIGEPYNFQVFDTCGSASATACKEPSR
  YINWDGVHLTEGMYKVMADM
Full Sequence
Protein Sequence     Length: 383     Download
MSPSISLILA TAVSTAILFL STISSAAPTS GVRRPFNRIY AFGDSFTDTG NSRSGEGPAG    60
FGHLSSFPYG MTYFLRPTNR YSDGRLTIDF VAQSMNLPFL PPYLSLRSTN GSKGTAADSY    120
GVNFAVSGAT VIEHSFFSEN NLTLDMTPQS IETELGWFEK YLETLETRDK VSLFNDSLFW    180
IGEIGVNDYA YTVGSAVSSD TIRELSISTH TRFLETLLNK GVRYMLVQGH PATGCLTLTM    240
TLAAQDDRDN LGCVKSVNNQ SYTHNLALQS KLEELRIKYP NATIVYADYW NAYRKVIKNP    300
SKYGISEKFK ACCGIGEPYN FQVFDTCGSA SATACKEPSR YINWDGVHLT EGMYKVMADM    360
FLDGSFTRPK FSYLLNKKLN GL*                                            420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01847Triacylglycerol_lipase_like9.0e-936363342+
COG3240COG32405.0e-1415362353+
PLN03156PLN031563.0e-2518362359+
cd01846fatty_acyltransferase_like2.0e-3238363326+
cd01837SGNH_plant_lipase_like2.0e-10339365334+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17921.10737813376unknown [Glycine max]
EMBLCBI14877.102437856407unnamed protein product [Vitis vinifera]
RefSeqNP_190416.1013821381GDSL-motif lipase/hydrolase family protein [Arabidopsis thaliana]
RefSeqXP_002274810.102437829380PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321669.103537831374predicted protein [Populus trichocarpa]
Metabolic Pathways
Pathway NameReactionECProtein Name
sinapate ester biosynthesisSINAPINE-ESTERASE-RXNEC-3.1.1.49sinapine esterase
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FD9533322441303730
DY02463724552490
EX040346257763320
DK47782524512450
DK477825242532760.22
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00316.1Aquca_003_00419.2Aquca_026_00042.1Aquca_003_00426.1Aquca_081_00039.1
Aquca_037_00027.1Aquca_056_00007.2Aquca_056_00007.1Aquca_011_00355.1Aquca_040_00030.1
Aquca_037_00028.1Aquca_040_00028.1Aquca_056_00007.4Aquca_056_00007.3Aquca_026_00039.1
Arabidopsis lyrata474829334218864389474754485206
909410
Arabidopsis thalianaAT1G54790.3AT1G56670.1AT1G09390.1AT1G54790.1AT4G01130.1
AT3G48460.1AT1G54790.2AT5G14450.1
Brachypodium distachyonBradi2g25920.4Bradi2g25920.1Bradi2g45280.1
Brassica rapaBra020025Bra038972Bra019545Bra040640Bra030108
Bra008757Bra039455Bra027918
Carica papayaevm.model.supercontig_184.1evm.model.supercontig_4.64
Capsella rubellaCarubv10020428mCarubv10001068mCarubv10011694mCarubv10020463mCarubv10017363m
Carubv10003515m
Citrus clementinaCiclev10020570mCiclev10000365mCiclev10023404m
Citrus sinensisorange1.1g017185morange1.1g016679morange1.1g017691morange1.1g018055morange1.1g016356m
Cucumis sativusCucsa.091760.1Cucsa.090420.1Cucsa.340130.1Cucsa.135890.1
Eucalyptus grandisEucgr.H01304.1Eucgr.B03271.1Eucgr.H02485.1Eucgr.D02341.2Eucgr.D02341.1
Fragaria vescamrna09914.1-v1.0-hybridmrna00284.1-v1.0-hybridmrna18929.1-v1.0-hybridmrna27870.1-v1.0-hybridmrna22302.1-v1.0-hybrid
Glycine maxGlyma16g03210.1Glyma07g06640.2Glyma07g06640.1Glyma17g18170.2Glyma03g40021.1
Glyma19g42560.2Glyma17g18170.1Glyma03g41580.1Glyma10g29820.1Glyma17g13600.1
Glyma03g40021.2Glyma05g02950.1Glyma19g42560.1Glyma16g07450.1Glyma08g13990.1
Glyma03g38890.1Glyma19g29810.1Glyma19g41470.1
Gossypium raimondiiGorai.007G294300.2Gorai.004G083600.3Gorai.004G083600.1Gorai.005G176800.1Gorai.007G105000.1
Gorai.011G094400.2Gorai.011G094400.1Gorai.008G204600.1Gorai.007G294300.1Gorai.011G094300.1
Gorai.004G083600.2
Linum usitatissimumLus10029980Lus10029639Lus10012644Lus10029638Lus10034763
Malus domesticaMDP0000764366MDP0000312022MDP0000263077MDP0000242118MDP0000134380
Manihot esculentacassava4.1_009552mcassava4.1_010326mcassava4.1_010282mcassava4.1_009992m
Medicago truncatulaMedtr7g113860.1AC233577_14.1Medtr6g007090.1Medtr7g116870.1Medtr4g104240.1
Medtr1g030220.1Medtr7g111780.1
Mimulus guttatusmgv11b006860mmgv11b006645mmgv1a008086mmgv1a008044mmgv1a021460m
Oryza sativaLOC_Os10g25340.1LOC_Os05g33270.1LOC_Os03g62740.1LOC_Os05g04240.1LOC_Os06g06520.1
Panicum virgatumPavirv00029923m
Physcomitrella patensPp1s518_11V6.1
Phaseolus vulgarisPhvul.010G108700.1Phvul.006G094100.1Phvul.003G239200.1Phvul.007G182500.1Phvul.008G155800.1
Phvul.003G208000.1Phvul.001G223500.1
Picea abiesMA_9754208g0010MA_5197g0010MA_114950g0010MA_5042g0010MA_10331604g0010
MA_75971g0010MA_10433283g0020
Populus trichocarpaPotri.013G015200.1Potri.005G038800.1Potri.015G089700.1Potri.002G216000.1Potri.014G094100.1
Potri.005G038800.2Potri.005G006500.1Potri.005G006500.2
Prunus persicappa023404mppa017417mppa001667mppa016576mppa007674m
ppa007486mppa007411mppa017062m
Ricinus communis29703.m00154730147.m01380930076.m00459730128.m00895130174.m008697
Setaria italicaSi001849mSi001792mSi004937mSi030054mSi030025m
Si008678mSi024357mSi022330m
Selaginella moellendorffii115333123499410344441488410418
15238152494115316542865258
80611709886583334430
Sorghum bicolorSb03g029650.1Sb01g001540.1Sb10g004120.1Sb02g037820.1Sb09g019710.1
Thellungiella halophilaThhalv10023524mThhalv10023535mThhalv10007968mThhalv10028725mThhalv10010448m
Thhalv10013537mThhalv10020927m
Vitis viniferaGSVIVT01000007001GSVIVT01027038001
Zea maysAC212068.4_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)