y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra022567
FamilyAA2
Protein PropertiesLength: 323 Molecular Weight: 35760 Isoelectric Point: 9.7226
ChromosomeChromosome/Scaffold: 02 Start: 8872321 End: 8873475
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2573080
  PARLLRMFFHDCFIRGCDASILLDSTMSTQAEKDGPPNISVRSFYVIEDAKRKLEKVCPRTVSCADVIAIAARDVVTLSGGPYWNVLKGRKDGTISRANE
  TINLPAPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFEARLQNFSKFHDVDPSMNYAFAQSLKKKCPRSNNRGKNAGTVLDSTSSVFDNDYY
  KQILSGKGVFGSDQALLGDYRTKWIVETFARDQKAFFREFATSMVKLGNFGV
Full Sequence
Protein Sequence     Length: 323     Download
MAFSKRLVFA MIFAVFAIVK PSEAALDAHY YDRSCPVAEK IILETVKNAT LYDPKVPARL    60
LRMFFHDCFI RGCDASILLD STMSTQAEKD GPPNISVRSF YVIEDAKRKL EKVCPRTVSC    120
ADVIAIAARD VVTLSGGPYW NVLKGRKDGT ISRANETINL PAPTFNVSQL IQSFAARGLS    180
VKDMVTLSGG HTIGFSHCSS FEARLQNFSK FHDVDPSMNY AFAQSLKKKC PRSNNRGKNA    240
GTVLDSTSSV FDNDYYKQIL SGKGVFGSDQ ALLGDYRTKW IVETFARDQK AFFREFATSM    300
VKLGNFGVKE TGQVRVNSRF VN*                                            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.000325728832+
cd00314plant_peroxidase_like2.0e-2242305294+
pfam00141peroxidase3.0e-5442193153+
PLN03030PLN030303.0e-7130315294+
cd00693secretory_peroxidase3.0e-15526321299+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN83265.10253225301hypothetical protein [Vitis vinifera]
RefSeqNP_200002.3013221322peroxidase [Arabidopsis thaliana]
RefSeqXP_002264451.101232214323PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268509.101232214323PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002510864.1053227323Peroxidase 66 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A0263222303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1fhf_C0263222303A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_B0263222303A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_A0263222303A Chain A, The Structure Of Soybean Peroxidase
PDB1qo4_A0263223304A Chain A, The Structure Of Soybean Peroxidase
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX10654527112710
DK48583025412540
EX775852264593220
EV52854925112510
EX02567221732190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00391.1Aquca_037_00288.1Aquca_003_00389.1Aquca_035_00197.1Aquca_003_00386.1
Aquca_003_00388.1Aquca_075_00004.1Aquca_047_00045.1Aquca_026_00115.1Aquca_037_00288.2
Aquca_015_00005.1Aquca_047_00046.1Aquca_017_00327.1Aquca_017_00324.1Aquca_007_00290.1
Aquca_026_00114.1Aquca_003_00387.1Aquca_075_00004.2
Arabidopsis lyrata495255913079917590896142878690
470522887707470523898628911467
325975909489345680
Arabidopsis thalianaAT5G51890.1AT4G33420.1AT5G42180.1AT3G01190.1AT5G15180.1
AT1G05260.1AT3G21770.1AT4G11290.1AT1G05250.1AT1G05240.1
AT2G39040.1
Brachypodium distachyonBradi2g12228.1Bradi2g34717.1Bradi2g12170.1Bradi2g12192.1Bradi2g12180.1
Bradi3g60880.1Bradi2g37000.1Bradi2g13190.1Bradi1g77140.1Bradi1g77130.1
Bradi3g32130.1Bradi2g37020.1Bradi1g42900.1Bradi1g15600.1Bradi2g37010.1
Bradi5g27687.1Bradi2g20830.1Bradi2g20840.1Bradi2g20850.1Bradi1g61530.1
Bradi2g11307.1Bradi2g11300.1Bradi1g61540.1Bradi1g59520.1Bradi5g22650.1
Bradi3g04717.1Bradi1g32870.1Bradi1g44790.1Bradi1g59550.1Bradi1g44800.1
Bradi2g20820.1Bradi1g61550.1Bradi2g11295.1Bradi4g40190.1Bradi2g37040.1
Bradi1g20027.1Bradi1g19980.1Bradi2g10150.1Bradi4g05980.1Bradi1g59537.1
Bradi2g52077.1Bradi3g55850.1Bradi2g37067.1Bradi2g37060.1Bradi2g37047.1
Bradi2g11320.1Bradi2g38660.1Bradi2g38690.1Bradi2g38680.1Bradi2g38670.1
Bradi2g37080.1Bradi2g38700.1Bradi2g38685.1Bradi2g12216.1Bradi2g12204.1
Bradi1g20010.1Bradi1g20020.1Bradi1g19990.1Bradi1g20000.1Bradi2g38720.1
Bradi2g37090.1Bradi3g32110.1
Brassica rapaBra001986Bra028285Bra021488Bra039137Bra032476
Bra030607Bra015402Bra023509Bra015403Bra030606
Bra037007Bra015404Bra023862Bra031309Bra035235
Bra011438Bra034561Bra032477Bra000113Bra032475
Bra032474
Carica papayaevm.model.supercontig_4.209evm.model.supercontig_26.281evm.model.supercontig_6.303evm.model.supercontig_3.163evm.model.supercontig_8.230
evm.model.supercontig_8.231evm.model.supercontig_198.1evm.model.supercontig_8.232evm.model.supercontig_9.151
Capsella rubellaCarubv10026787mCarubv10028504mCarubv10016167mCarubv10012652mCarubv10012469m
Carubv10003841mCarubv10001453mCarubv10005237mCarubv10009829mCarubv10014176m
Carubv10001445mCarubv10025622m
Citrus clementinaCiclev10021010mCiclev10006448mCiclev10017908mCiclev10001877mCiclev10027084m
Ciclev10007121mCiclev10005432mCiclev10026072mCiclev10015924m
Citrus sinensisorange1.1g020883morange1.1g041695morange1.1g019585morange1.1g021118morange1.1g021430m
orange1.1g020619morange1.1g020635morange1.1g017040morange1.1g019629morange1.1g048664m
Cucumis sativusCucsa.251120.1Cucsa.128460.1Cucsa.393950.1Cucsa.128450.1Cucsa.128470.1
Cucsa.043880.1Cucsa.072840.1Cucsa.170030.1Cucsa.148370.1Cucsa.363350.1
Cucsa.390630.1Cucsa.128490.1Cucsa.128480.1
Eucalyptus grandisEucgr.F03724.1Eucgr.A02844.1Eucgr.H03915.1Eucgr.H03910.1Eucgr.H00888.1
Eucgr.L00890.1Eucgr.J01616.1Eucgr.H00890.1Eucgr.A00966.1Eucgr.A01385.1
Eucgr.J01619.1Eucgr.J01618.1Eucgr.L02416.1Eucgr.J01614.1Eucgr.J01617.1
Eucgr.H00887.1Eucgr.H00889.1Eucgr.G01637.1Eucgr.J02484.1Eucgr.L02417.1
Eucgr.L02524.1Eucgr.J01615.1Eucgr.E03708.1Eucgr.E03715.1Eucgr.C02744.1
Eucgr.E03716.1Eucgr.E04120.1Eucgr.C02751.1Eucgr.C02747.1Eucgr.H03667.1
Eucgr.H01218.1Eucgr.H03666.1Eucgr.H00891.1Eucgr.K00806.1Eucgr.E04121.1
Eucgr.B01255.1Eucgr.K00809.1
Fragaria vescamrna22932.1-v1.0-hybridmrna06887.1-v1.0-hybridmrna19544.1-v1.0-hybridmrna03588.1-v1.0-hybridmrna12445.1-v1.0-hybrid
mrna14551.1-v1.0-hybridmrna23915.1-v1.0-hybridmrna23913.1-v1.0-hybridmrna13352.1-v1.0-hybridmrna06699.1-v1.0-hybrid
mrna11144.1-v1.0-hybridmrna31145.1-v1.0-hybrid
Glycine maxGlyma10g38520.1Glyma09g27390.1Glyma09g42130.1Glyma10g33520.1Glyma04g40530.1
Glyma09g42160.1Glyma20g00330.1Glyma14g40150.1Glyma10g01250.1Glyma10g01230.1
Glyma02g01190.1Glyma11g08520.1Glyma01g36780.1Glyma02g17060.1Glyma01g36780.2
Glyma12g32160.1Glyma13g38310.2Glyma03g36620.2Glyma20g35680.1Glyma09g28460.1
Glyma16g33250.1Glyma06g45920.1Glyma06g45910.1Glyma10g02730.1Glyma13g38300.1
Glyma12g32170.1Glyma12g10850.1Glyma06g45910.2Glyma03g36610.1Glyma16g32490.1
Glyma19g39270.2
Gossypium raimondiiGorai.003G006600.1Gorai.008G264300.1Gorai.008G007500.1Gorai.004G049000.1Gorai.004G049100.1
Gorai.004G049200.1Gorai.008G172200.1Gorai.009G192200.1Gorai.005G150500.1Gorai.010G001900.1
Gorai.008G172200.2Gorai.008G281600.1Gorai.012G046400.1Gorai.008G007700.1Gorai.011G184500.1
Gorai.011G184600.1Gorai.008G007600.1Gorai.013G099400.1Gorai.013G099600.1Gorai.005G150600.1
Gorai.005G150600.2Gorai.006G074900.1Gorai.013G099500.1
Linum usitatissimumLus10031664Lus10027405Lus10034547Lus10028736Lus10017288
Lus10005614Lus10032926Lus10028688Lus10038054Lus10027163
Lus10039681Lus10018374Lus10007638Lus10029543Lus10006756
Lus10015580Lus10039680Lus10041250Lus10027164Lus10021956
Lus10038055Lus10041249Lus10009990Lus10015127Lus10031548
Lus10020064
Malus domesticaMDP0000272643MDP0000451182MDP0000598572MDP0000678562MDP0000514027
MDP0000175043MDP0000509949MDP0000862126MDP0000218284MDP0000266658
MDP0000620579MDP0000849735MDP0000643021MDP0000449389MDP0000206768
MDP0000149327
Manihot esculentacassava4.1_030462mcassava4.1_024888mcassava4.1_026282mcassava4.1_022712mcassava4.1_030389m
cassava4.1_030603mcassava4.1_029175mcassava4.1_030116mcassava4.1_012142mcassava4.1_031318m
cassava4.1_026031mcassava4.1_026378mcassava4.1_011768mcassava4.1_011775mcassava4.1_023556m
cassava4.1_029372mcassava4.1_029294mcassava4.1_025818mcassava4.1_030342mcassava4.1_027519m
cassava4.1_031448mcassava4.1_023964mcassava4.1_026755mcassava4.1_028760m
Medicago truncatulaMedtr1g101830.1Medtr1g038680.1Medtr1g086320.1Medtr3g092990.1Medtr1g025980.1
Medtr3g092990.2Medtr8g075100.1Medtr5g022870.1Medtr1g086490.1Medtr7g035030.1
Medtr2g088770.1
Mimulus guttatusmgv1a010371mmgv1a010308mmgv1a010125mmgv1a009735mmgv1a009721m
mgv1a009971mmgv1a010695mmgv1a009942mmgv1a019406mmgv11b018535m
mgv1a009726mmgv1a017718mmgv1a010045mmgv1a009974mmgv1a021569m
mgv1a010031mmgv1a009213mmgv1a026649mmgv1a010025mmgv1a010112m
mgv1a010413mmgv1a022629mmgv1a009766mmgv1a009821mmgv1a009818m
mgv1a009802mmgv1a027126mmgv1a010460mmgv1a019767m
Oryza sativaLOC_Os05g06970.1LOC_Os01g22336.1LOC_Os01g22370.1LOC_Os07g34710.1LOC_Os02g58720.2
LOC_Os02g58720.1LOC_Os05g04500.1LOC_Os03g02939.1LOC_Os03g02920.1LOC_Os10g39170.1
LOC_Os11g43980.1LOC_Os05g04490.1LOC_Os07g01420.1LOC_Os03g25370.1LOC_Os07g01370.1
LOC_Os06g20150.1LOC_Os06g29470.1LOC_Os05g41990.1LOC_Os07g34670.1LOC_Os03g25360.1
LOC_Os06g46799.1LOC_Os05g04470.1LOC_Os07g44590.1LOC_Os05g04450.1LOC_Os07g06300.1
LOC_Os07g06190.1LOC_Os04g53640.1LOC_Os05g42000.1LOC_Os03g36560.1LOC_Os07g44550.1
LOC_Os03g25340.1LOC_Os01g22230.1LOC_Os03g25320.1LOC_Os07g44480.1LOC_Os07g44499.1
LOC_Os03g25300.1LOC_Os03g25280.1LOC_Os03g25330.1LOC_Os01g22249.1LOC_Os07g44460.1
LOC_Os01g18890.1LOC_Os07g01400.1LOC_Os01g28030.1LOC_Os02g06630.1LOC_Os02g58720.3
LOC_Os12g34524.1LOC_Os01g16450.1LOC_Os01g22230.2LOC_Os01g57730.1LOC_Os07g01410.1
LOC_Os07g34710.3LOC_Os07g34710.2LOC_Os05g04410.1LOC_Os04g04750.1LOC_Os01g18930.1
LOC_Os05g04380.1LOC_Os01g19020.1LOC_Os07g06175.1LOC_Os01g18970.1LOC_Os05g04440.1
LOC_Os07g06380.1LOC_Os01g18950.1LOC_Os05g04380.2LOC_Os01g22352.1LOC_Os10g39160.1
LOC_Os01g18910.1
Panicum virgatumPavirv00044436mPavirv00035344mPavirv00016231mPavirv00045234mPavirv00067047m
Pavirv00050773mPavirv00036782mPavirv00065543mPavirv00036784mPavirv00000823m
Pavirv00015735mPavirv00033829mPavirv00037097mPavirv00049652mPavirv00051773m
Pavirv00055968mPavirv00012325mPavirv00006439mPavirv00068608mPavirv00000691m
Pavirv00006153mPavirv00040480mPavirv00069183mPavirv00069497mPavirv00012470m
Pavirv00046769mPavirv00040468mPavirv00015808mPavirv00044710mPavirv00059241m
Pavirv00014977mPavirv00050593mPavirv00009813mPavirv00011553mPavirv00016723m
Pavirv00052170mPavirv00034630mPavirv00059415mPavirv00002373mPavirv00049434m
Pavirv00040863mPavirv00012420mPavirv00054164mPavirv00036783mPavirv00067809m
Pavirv00059393mPavirv00042375mPavirv00054722mPavirv00045339mPavirv00029237m
Pavirv00054723mPavirv00000698mPavirv00064219mPavirv00066428mPavirv00055085m
Pavirv00064221mPavirv00014089mPavirv00004916mPavirv00036786mPavirv00049155m
Pavirv00041015mPavirv00036156mPavirv00054042mPavirv00049735mPavirv00041743m
Pavirv00010288mPavirv00053333mPavirv00040553mPavirv00044012mPavirv00049438m
Pavirv00034846mPavirv00010289mPavirv00012102mPavirv00036142mPavirv00064220m
Pavirv00033031mPavirv00048030mPavirv00032795mPavirv00062564mPavirv00026218m
Pavirv00014323mPavirv00056122mPavirv00062109mPavirv00009815mPavirv00001774m
Pavirv00049838mPavirv00057639mPavirv00050644mPavirv00031771mPavirv00009814m
Pavirv00002032mPavirv00017683mPavirv00041363mPavirv00047668mPavirv00023480m
Pavirv00003693mPavirv00057171mPavirv00033836m
Physcomitrella patensPp1s385_42V6.1Pp1s201_38V6.1Pp1s160_154V6.1Pp1s411_26V6.1Pp1s89_182V6.1
Pp1s55_121V6.2Pp1s55_121V6.1Pp1s66_27V6.1Pp1s356_14V6.1Pp1s67_214V6.5
Pp1s67_214V6.4Pp1s67_214V6.3Pp1s67_214V6.2Pp1s67_214V6.1Pp1s1_302V6.1
Pp1s43_154V6.1Pp1s20_77V6.1
Phaseolus vulgarisPhvul.004G123100.1Phvul.007G065800.1Phvul.009G038500.1Phvul.003G003200.1Phvul.001G076000.1
Phvul.003G003100.1Phvul.001G003800.1Phvul.002G105400.1Phvul.007G211100.1Phvul.007G210900.1
Phvul.001G201300.1Phvul.007G114200.1Phvul.004G132000.1Phvul.011G105900.1Phvul.005G113800.1
Phvul.007G167200.1
Picea abiesMA_10431507g0020MA_750042g0010MA_102298g0010MA_412995g0010MA_5316g0010
MA_114903g0010MA_10435488g0010MA_93508g0010MA_63572g0010MA_9087g0010
MA_183305g0010MA_10433564g0020MA_87008g0010MA_46801g0010MA_9457778g0010
MA_651584g0010MA_18523g0010MA_163g0010MA_12626g0010MA_180698g0010
MA_41416g0010MA_115059g0010MA_188077g0010MA_10435488g0020MA_389258g0010
MA_9540939g0010MA_10428759g0010MA_774247g0010MA_10259419g0010MA_182004g0010
MA_10433564g0010MA_186946g0010MA_117730g0010MA_644225g0010MA_7239782g0010
Populus trichocarpaPotri.015G003600.1Potri.015G003500.1Potri.015G003500.2Potri.012G042800.1Potri.007G122300.1
Potri.007G122200.1Potri.005G108900.1Potri.002G018000.1Potri.007G122100.1Potri.017G038100.2
Potri.017G038100.1Potri.017G037900.1Potri.004G023200.1Potri.004G023100.1Potri.012G006800.2
Potri.012G006800.1Potri.004G134800.1Potri.T045500.1Potri.011G027300.1Potri.T099300.1
Potri.019G063200.1Potri.T089600.1Potri.017G037900.2Potri.018G136900.1Potri.015G138300.1
Prunus persicappa020970mppa008831mppa025326mppa015674mppa008896m
ppa008516mppa016743mppa008540mppa014996mppa014723m
ppa023088mppa024711mppa023401m
Ricinus communis27446.m00049229726.m00403728333.m00058227446.m00049430086.m000208
28962.m00043230170.m01427530147.m01413129726.m00396530156.m001761
29647.m002045.49.30529647.m002045.49.30529983.m00329529842.m00365429647.m002045.413.667
29647.m002045.413.66729726.m00396630156.m00176027446.m000493
Setaria italicaSi001958mSi010431mSi001913mSi010419mSi017767m
Si039828mSi036556mSi010422mSi025196mSi025162m
Si017751mSi036635mSi006880mSi032112mSi006881m
Si020699mSi014105mSi006873mSi022656mSi006871m
Si036566mSi030304mSi030495mSi024230mSi025059m
Si032029mSi001988mSi024554mSi033034mSi010487m
Si022555mSi020718mSi017675mSi002089mSi036439m
Si022615mSi039321mSi002248mSi040234mSi033206m
Si031937mSi036455mSi004255mSi003948mSi030179m
Si020698mSi020695mSi002064mSi017708mSi017693m
Si022557mSi002047mSi002052mSi029563mSi027715m
Si030855mSi030214mSi032796mSi022679mSi002666m
Selaginella moellendorffii177154126670429447266691229953
232359134234409361233332232728
407109
Sorghum bicolorSb03g013220.1Sb09g004660.1Sb03g013190.1Sb03g013200.1Sb04g038610.1
Sb08g016840.1Sb01g049140.1Sb09g004650.1Sb05g004180.1Sb09g002810.1
Sb01g030530.1Sb09g002830.1Sb04g031120.1Sb02g000470.1Sb10g011510.1
Sb10g011290.1Sb2674s002010.1Sb02g040770.1Sb07g001280.1Sb10g011530.1
Sb09g024580.1Sb10g027490.1Sb02g040740.1Sb09g024590.1Sb01g034420.1
Sb02g040750.1Sb09g002750.1Sb06g029370.1Sb04g004250.1Sb02g000490.1
Sb01g016600.1Sb03g011950.1Sb03g011960.1Sb09g002820.1Sb01g034430.2
Sb01g034430.1Sb09g002760.1Sb03g013210.1Sb02g040670.1Sb02g040680.1
Sb03g016510.1Sb03g010740.1Sb03g036760.1Sb01g004160.1Sb02g040690.1
Sb02g000520.1Sb04g020720.1Sb09g002740.1Sb03g011990.1Sb03g011980.1
Sb02g040730.1Sb02g040660.1Sb01g030540.1Sb02g040710.1Sb02g040720.1
Sb09g002770.1Sb02g000500.1Sb02g000510.1
Thellungiella halophilaThhalv10014117mThhalv10027848mThhalv10025702mThhalv10014085mThhalv10021152m
Thhalv10008157mThhalv10008202mThhalv10008189mThhalv10021123mThhalv10028797m
Thhalv10016858mThhalv10028329m
Vitis viniferaGSVIVT01018436001GSVIVT01008763001GSVIVT01005386001GSVIVT01031311001GSVIVT01028197001
GSVIVT01010664001GSVIVT01031312001.283.542GSVIVT01031312001.283.542GSVIVT01038659001.47.306GSVIVT01038659001.47.306
GSVIVT01000248001GSVIVT01030616001.52.310GSVIVT01030616001.52.310GSVIVT01030615001GSVIVT01011017001
GSVIVT01017830001GSVIVT01030616001.393.579GSVIVT01030616001.393.579GSVIVT01031312001.46.196GSVIVT01031312001.46.196
GSVIVT01038659001.403.563GSVIVT01038659001.403.563GSVIVT01004088001GSVIVT01007225001GSVIVT01012624001
Zea maysAC205413.4_FGT001AC205413.4_FGT003AC208341.4_FGT007AC205413.4_FGT002AC205154.3_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)