y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra024441
FamilyGH43
Protein PropertiesLength: 470 Molecular Weight: 52944.1 Isoelectric Point: 7.8295
ChromosomeChromosome/Scaffold: 06 Start: 15784306 End: 15785902
DescriptionArabinanase/levansucrase/invertase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH431633931.8e-34
  ILHDDKSNTYYWYGEYKDGPTYHAHKKGPARVDIIGVGCYSSKDLWTWKNEGIVLGAEDTNKTHDLHKSNVLERPKVIYNDKTGKYVMWMHIDDANYTKA
  SVGVAISDNPTGPFEYLYSKRPHGFDSRDMTVFKDDDGVAYLFYSSEVNSVLHIGPLTEDYLDVTPVMKKVMVGQHREAPAIFKHESTYYMITSWCTGWA
  PNEALAHAAESIMGPWEKLGNPCVGGNKVFR
Full Sequence
Protein Sequence     Length: 470     Download
MPGNSASLGL LRGFSGGGCR HSLLTIVWTV VGFLLVTHLI SLYTRKDNNI DAQQQHQPPS    60
HHLQQLPPPA LHDLVRVEEE ILRLPPPRKR SPRTGKRRSR KPIPLAEEFL DDKSPIRHLF    120
FPDIKTSSFG PTKDMGNDAF HYSPGKIWLD TEGNPIQAHG GGILHDDKSN TYYWYGEYKD    180
GPTYHAHKKG PARVDIIGVG CYSSKDLWTW KNEGIVLGAE DTNKTHDLHK SNVLERPKVI    240
YNDKTGKYVM WMHIDDANYT KASVGVAISD NPTGPFEYLY SKRPHGFDSR DMTVFKDDDG    300
VAYLFYSSEV NSVLHIGPLT EDYLDVTPVM KKVMVGQHRE APAIFKHEST YYMITSWCTG    360
WAPNEALAHA AESIMGPWEK LGNPCVGGNK VFRLTTFFAQ STYVIPLPGV PGAFVFMADR    420
WNPADLRDSR YVWLPLVVGG PADQPLESSF GFPMWSRVSI YWHSKWHLP*               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08999GH43_ABN_26.0e-17201384202+
cd09004GH43_bXyl6.0e-21200383194+
cd08990GH43_AXH_like9.0e-23201379193+
cd08978GH_F6.0e-54170437279+
cd08985GH43_66.0e-130156438284+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI33680.106946927427unnamed protein product [Vitis vinifera]
RefSeqNP_190557.102046916458glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqNP_201555.2014691466glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqNP_975008.101646919471glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqXP_002525277.101746948492beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F014543645328A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase
PDB3vt2_E014543645328A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase
PDB3vt2_D014543645328A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase
PDB3vt2_C014543645328A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase
PDB3vt2_B014543645328A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8561533301394680
GO3743623451314690
EY7037302951534470
ES9036022362354700
GO8017532941764690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.2AT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi1g71160.1Bradi2g50980.1
Brassica rapaBra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1Gorai.003G030500.2
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2LOC_Os01g65720.1
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.003G234900.1Phvul.002G010600.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny