y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra027291
FamilyGT31
Protein PropertiesLength: 344 Molecular Weight: 38555.5 Isoelectric Point: 8.7816
ChromosomeChromosome/Scaffold: 05 Start: 20148664 End: 20150517
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT31992910
  RRRALRSTWMPSDPEGLRRLEESTGLAIRFIIGKTKDEKKMAELRREIAEYDDFILLDIEEEYSKLPYKTLAFFKAAYALYDSEFYVKADDDIYLRPDRL
  SLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLADLLGKEYFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHEN
Full Sequence
Protein Sequence     Length: 344     Download
MPSSPRLKLF HARTSPSTRR STSLIVLTSL AIGLFGFIFG LSAIVFPSRT CLTNSPPKTV    60
KVVWDVAGNS NGNGLSGGVK RHKVMGFVGI QTGFGSAGRR RALRSTWMPS DPEGLRRLEE    120
STGLAIRFII GKTKDEKKMA ELRREIAEYD DFILLDIEEE YSKLPYKTLA FFKAAYALYD    180
SEFYVKADDD IYLRPDRLSL LLAKERSHSQ TYLGCLKKGP VFTDPKLKWY EPLADLLGKE    240
YFLHAYGPIY ALSADVVTSL VALKNNSFRM FSNEDVTIGA WMLAMNVNHE NHKTLCEREC    300
SPYSIAVWDI PKCSGLCNPE KRMLELHKIE SCSKSPTLPS EDE*                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03133PLN031334.0e-1587312240+
PLN03193PLN031939.0e-4881328266+
pfam01762Galactosyl_T1.0e-5099291201+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF69535.1043433353AC008007_10 F12M16.19 [Arabidopsis thaliana]
RefSeqNP_175736.2043433345galactosyltransferase family protein [Arabidopsis thaliana]
RefSeqNP_188114.1013431343galactosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002317466.10273421326predicted protein [Populus trichocarpa]
RefSeqXP_002330737.1013421351predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
2345
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV538084265803440
DR935688260833420
EX525508300463430
DY27237132713150
DY272371253113359.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_081_00004.1
Arabidopsis lyrata474455901308897766
Arabidopsis thalianaAT1G53290.1AT3G14960.1AT2G26100.1
Brachypodium distachyonBradi2g33090.1Bradi1g48880.1
Brassica rapaBra038114Bra001576Bra034289
Carica papayaevm.model.supercontig_97.96
Capsella rubellaCarubv10023358mCarubv10009980mCarubv10009620mCarubv10014091m
Citrus clementinaCiclev10020877mCiclev10008876mCiclev10010334m
Citrus sinensisorange1.1g018669morange1.1g018637morange1.1g020201m
Cucumis sativusCucsa.122670.1Cucsa.122670.2
Eucalyptus grandisEucgr.F03260.2Eucgr.F03260.1Eucgr.F03260.5Eucgr.F01224.1Eucgr.F03260.3
Eucgr.F03260.4Eucgr.C03050.1
Fragaria vescamrna27228.1-v1.0-hybridmrna02689.1-v1.0-hybrid
Glycine maxGlyma13g34630.1Glyma06g33880.1Glyma20g09170.1
Gossypium raimondiiGorai.009G368400.1Gorai.009G368400.2Gorai.010G100900.1Gorai.002G062000.1
Linum usitatissimumLus10014451Lus10023955Lus10013683
Malus domesticaMDP0000323739MDP0000306900MDP0000237443
Manihot esculentacassava4.1_010336mcassava4.1_011023m
Mimulus guttatusmgv1a009062m
Oryza sativaLOC_Os06g06280.1LOC_Os06g06280.2LOC_Os05g11060.1LOC_Os05g11060.2
Panicum virgatumPavirv00018938mPavirv00043119mPavirv00019539mPavirv00061117mPavirv00048022m
Pavirv00036678m
Physcomitrella patensPp1s34_219V6.1Pp1s65_64V6.1
Phaseolus vulgarisPhvul.005G067100.1Phvul.011G159800.1
Picea abiesMA_10428560g0010MA_10426473g0010
Populus trichocarpaPotri.006G228900.3Potri.006G228900.4Potri.006G228900.1Potri.006G228900.2Potri.011G111700.2
Potri.011G111700.1Potri.001G392700.1
Prunus persicappa007915mppa007437m
Ricinus communis30150.m00048629794.m003321
Setaria italicaSi022377mSi006727m
Selaginella moellendorffii5630166328
Sorghum bicolorSb09g006190.1Sb10g003920.1
Thellungiella halophilaThhalv10021058mThhalv10002018mThhalv10011624m
Vitis viniferaGSVIVT01035404001GSVIVT01014218001
Volvox carteriVocar20001878m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)