y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra034233
FamilyCBM43
Protein PropertiesLength: 111 Molecular Weight: 12174.7 Isoelectric Point: 7.2441
ChromosomeChromosome/Scaffold: 01 Start: 26823278 End: 26823610
DescriptionCarbohydrate-binding X8 domain superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM43221012.3e-32
  WCVARPSASQAELQRALDWACGIGRVDCSVIEKHGDCYEPDTIWSHASFAFNAYYQTNGNNRIACYFGGTATLTKINPSK
Full Sequence
Protein Sequence     Length: 111     Download
MIRPESPIRP EGNTTFLDGT TWCVARPSAS QAELQRALDW ACGIGRVDCS VIEKHGDCYE    60
PDTIWSHASF AFNAYYQTNG NNRIACYFGG TATLTKINPS KFLAPSRVLQ *             120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X82.0e-22219382+
smart00768X84.0e-372110080+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ85566.19.94922e-441010045135unknown [Medicago truncatula]
GenBankACU17215.18.00001e-411010042132unknown [Glycine max]
EMBLCAB81085.1021103111putative protein [Arabidopsis thaliana]
RefSeqNP_192452.2021003101unknown protein [Arabidopsis thaliana]
RefSeqXP_002274294.19.99967e-421010021111PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jon_A3e-17211001290A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF65246610021010
EV25599391101008.00141e-43
FF39833992101011.99993e-41
JG52617090111003.00004e-41
EB71551190111004.99997e-41
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00306.1Aquca_034_00008.2Aquca_034_00008.1Aquca_057_00054.1Aquca_005_00012.2.387.468
Aquca_005_00012.1.387.468Aquca_029_00060.1Aquca_005_00012.3.387.465Aquca_003_00345.1Aquca_042_00173.1.359.441
Aquca_022_00096.1Aquca_032_00084.2.385.463Aquca_032_00084.1.386.464Aquca_032_00084.5.385.461Aquca_020_00396.2.385.464
Aquca_032_00084.4.385.467Aquca_032_00084.3.386.468Aquca_020_00396.1.385.467Aquca_028_00029.2.380.458Aquca_028_00029.3.368.451
Aquca_028_00029.1.380.463Aquca_091_00065.2.363.444Aquca_091_00065.1.363.444Aquca_009_00463.1.361.442Aquca_004_00485.1.286.364
Aquca_004_00728.1.368.449Aquca_005_00103.2Aquca_005_00103.1Aquca_004_00728.2.368.447Aquca_057_00058.1
Aquca_005_00256.1
Arabidopsis lyrata496849484077.361.442495603.373.456478745.363.444879428.382.459
913572.392.474867248480193.385.468327458329002.368.451
894267.367.448870710879141869363881229
915703899301477115493553918818.369.451
Arabidopsis thalianaAT5G56590.1.369.451AT1G09460.1AT4G13600.1AT5G67460.1AT1G11820.2.382.463
AT2G01630.1.361.442AT3G13560.3.363.444AT3G13560.2.363.444AT3G13560.1.363.444AT1G29380.1
AT4G26830.1.367.450AT4G29360.1.391.473AT3G58100.1AT4G29360.2.391.470AT2G05790.1.384.467
AT4G05430.1AT5G55180.2.372.450AT1G66250.1.369.450AT5G55180.1.372.455AT2G30933.2
AT2G30933.1AT5G35740.1AT2G04910.1AT2G04910.2AT1G79480.2
AT1G79480.1
Brachypodium distachyonBradi1g58357.1Bradi3g57610.1.407.490Bradi4g26820.1Bradi2g15280.1Bradi1g26510.1.392.473
Bradi1g25530.1.374.454Bradi1g25530.1.374.454Bradi1g25517.1.474.556Bradi1g25517.1.474.556Bradi1g25517.1.388.464
Bradi1g25517.1.388.464Bradi1g25530.1.461.542Bradi1g25530.1.461.542Bradi2g49330.2.366.448Bradi2g49330.1.366.448
Bradi1g69610.1.364.445Bradi1g23640.1.373.454Bradi1g39060.1Bradi1g61320.1.241.322Bradi1g20370.1
Bradi2g26406.1Bradi5g21510.1Bradi1g31870.1Bradi1g02750.1Bradi3g43830.1
Bradi2g44390.1Bradi2g50750.1Bradi1g22290.1Bradi4g03190.1Bradi2g20070.1
Bradi3g15940.1
Brassica rapaBra035561.372.455Bra021679Bra032719Bra008414Bra027421.367.448
Bra031835Bra016812.386.467Bra019084.405.488Bra026644.361.442Bra011100.357.439
Bra004688Bra010330.377.459Bra020023Bra002805.355.437Bra015166.385.468
Bra039757.370.451Bra028988.487.570Bra030780Bra003318Bra002927.374.453
Bra032314Bra035382Bra010831Bra035122
Carica papayaevm.model.supercontig_50.88evm.model.supercontig_152.27.385.463evm.model.supercontig_209.11evm.model.supercontig_6.30evm.model.supercontig_2.222.352.433
evm.model.supercontig_17.124evm.model.supercontig_136.19evm.model.supercontig_132.21.373.455evm.model.supercontig_48.219evm.model.supercontig_116.58.361.439
evm.model.supercontig_2750.1evm.model.supercontig_8.263evm.model.supercontig_32.84evm.model.supercontig_83.1evm.model.supercontig_12.252.372.456
evm.model.supercontig_78.32.367.449
Capsella rubellaCarubv10026261m.371.453Carubv10009486mCarubv10005790mCarubv10027495mCarubv10012467m.346.427
Carubv10026374m.369.452Carubv10019481m.361.442Carubv10004853m.344.427Carubv10007158m.393.475Carubv10013604m.387.470
Carubv10002833mCarubv10019942m.504.585Carubv10024176mCarubv10013514m.363.444Carubv10024005m
Carubv10006360mCarubv10015550mCarubv10015739mCarubv10011350mCarubv10020684m
Carubv10016031mCarubv10019163m
Citrus clementinaCiclev10006028mCiclev10005883mCiclev10014440m.182.263Ciclev10025640m.348.430Ciclev10008176m.385.468
Ciclev10016863mCiclev10018075mCiclev10008080m.367.449Ciclev10015086m.392.474Ciclev10014990m.362.443
Ciclev10011380mCiclev10011295mCiclev10016513mCiclev10017213mCiclev10015028m.362.443
Ciclev10011549m.361.442Ciclev10015027m.362.443Ciclev10017199mCiclev10013846mCiclev10022230m
Ciclev10032559mCiclev10005428m
Citrus sinensisorange1.1g048481morange1.1g036155morange1.1g030415morange1.1g010394m.369.450orange1.1g012052m.384.467
orange1.1g011551m.384.462orange1.1g011895m.384.463orange1.1g013292m.367.445orange1.1g010782m.367.449orange1.1g009301m.452.532
orange1.1g010833m.362.443orange1.1g006966morange1.1g048380morange1.1g047041morange1.1g011132m.362.443
orange1.1g011131m.362.443orange1.1g010931m.361.442orange1.1g033379morange1.1g040368morange1.1g029395m
orange1.1g028392m
Cucumis sativusCucsa.367120.1Cucsa.085740.1.380.461Cucsa.185010.2Cucsa.042790.1.370.453Cucsa.185010.1
Cucsa.166770.2Cucsa.166770.1Cucsa.185070.1.388.467Cucsa.212490.1Cucsa.120380.1
Cucsa.185070.2.254.337Cucsa.029930.2.328.409Cucsa.029930.1.361.442Cucsa.029930.3.361.437Cucsa.006230.2.346.428
Cucsa.006230.1.368.450Cucsa.047450.1Cucsa.118190.1Cucsa.355790.1.360.441Cucsa.153140.1.364.440
Cucsa.355790.4.360.438Cucsa.355790.3.360.438Cucsa.355790.2.360.438Cucsa.050890.1Cucsa.180520.1
Cucsa.113180.2Cucsa.113180.1Cucsa.058280.1Cucsa.239920.1Cucsa.193950.1
Cucsa.193950.2Cucsa.288710.2.291.373Cucsa.288710.1.369.448
Eucalyptus grandisEucgr.A00950.1Eucgr.H01316.2Eucgr.D01339.1.381.462Eucgr.H04823.1Eucgr.E04042.1.393.474
Eucgr.D01339.2.381.458Eucgr.A01095.2.386.468Eucgr.A01095.1.389.471Eucgr.A01979.1Eucgr.G02118.1.362.443
Eucgr.F03495.1.368.450Eucgr.C03710.1.366.448Eucgr.K00648.1Eucgr.E02359.1Eucgr.F02860.2.365.446
Eucgr.F02860.1.365.446Eucgr.B03614.1.362.444Eucgr.H01316.1Eucgr.K01086.1Eucgr.G02674.1
Eucgr.D01439.1
Fragaria vescamrna06678.1-v1.0-hybridmrna24890.1-v1.0-hybridmrna05734.1-v1.0-hybridmrna24806.1-v1.0-hybrid.319.401mrna30530.1-v1.0-hybrid.370.451
mrna19637.1-v1.0-hybrid.571.652mrna01212.1-v1.0-hybrid.390.473mrna00118.1-v1.0-hybridmrna19809.1-v1.0-hybridmrna21593.1-v1.0-hybrid
mrna22924.1-v1.0-hybridmrna03446.1-v1.0-hybrid.376.459mrna18474.1-v1.0-hybridmrna28713.1-v1.0-hybridmrna17802.1-v1.0-hybrid
mrna11332.1-v1.0-hybrid.366.448mrna22713.1-v1.0-hybridmrna25805.1-v1.0-hybrid
Glycine maxGlyma20g06250.2Glyma09g11676.2Glyma09g11676.1Glyma15g23435.1Glyma08g11810.2
Glyma08g11810.1Glyma05g28691.1Glyma11g05230.1Glyma07g39140.5.381.462Glyma07g39140.4.381.462
Glyma07g39140.3.381.462Glyma19g41371.1Glyma01g40060.1.308.390Glyma17g01601.2.404.485Glyma17g01601.1.404.485
Glyma15g11560.1.199.282Glyma03g38770.2Glyma18g04560.1.361.442Glyma14g39510.4.328.409Glyma14g39510.2.413.494
Glyma02g41190.1.362.443Glyma11g36490.1Glyma02g43640.1.384.467Glyma14g05300.1.383.466Glyma05g28700.1
Glyma02g45470.1Glyma08g12020.1.362.443Glyma17g29820.4.362.443Glyma17g29820.3.362.443Glyma17g29820.2.362.443
Glyma05g28870.1.362.443Glyma14g16630.2.365.446Glyma12g33610.1Glyma06g43741.1Glyma18g12770.1
Glyma14g03221.1Glyma16g26800.6.239.320Glyma16g26800.3.311.392Glyma16g26800.1.328.409Glyma08g42200.1
Glyma13g36860.2Glyma05g29810.2Glyma05g29790.2Glyma08g13690.2Glyma08g13690.1
Glyma05g30540.3Glyma05g30540.2Glyma16g26800.4.311.390Glyma14g01030.1Glyma08g12910.1
Glyma16g26800.7.239.316Glyma16g26800.5.311.388Glyma16g26800.2.328.405Glyma02g07730.1.361.442Glyma02g47620.1
Glyma08g12910.2Glyma08g04780.2.365.446Glyma05g34930.2.360.441Glyma05g35955.1.366.448Glyma08g03670.1.366.448
Glyma17g01140.1Glyma07g39671.1Glyma11g33650.1.361.442Glyma14g39510.3.413.491Glyma20g22525.1
Glyma10g28475.1Glyma14g02350.1.373.456Glyma02g46330.1.384.467Glyma08g42200.2Glyma15g41630.2
Glyma08g17511.1Glyma12g14156.1Glyma13g36860.1Glyma13g36860.3
Gossypium raimondiiGorai.005G032500.2Gorai.005G032500.1Gorai.011G156800.1Gorai.009G179400.2.384.465Gorai.009G179400.1.384.465
Gorai.008G082600.3.317.399Gorai.008G082600.2.330.412Gorai.008G082600.1.330.409Gorai.005G034300.1Gorai.004G064200.1.361.442
Gorai.002G092600.2.382.465Gorai.002G092600.1.382.465Gorai.009G442700.1.381.464Gorai.001G216900.5.248.331Gorai.001G216900.4.381.464
Gorai.001G216900.3.381.464Gorai.001G216900.2.381.464Gorai.011G124300.1Gorai.001G216900.1.381.460Gorai.002G174100.3.328.409
Gorai.002G174100.1.361.442Gorai.009G179400.3.384.463Gorai.006G093900.2Gorai.006G093900.1Gorai.009G028300.2.392.474
Gorai.009G028300.1.392.470Gorai.009G028200.1.457.539Gorai.009G028200.1.457.539Gorai.009G028200.1.361.443Gorai.009G028200.1.361.443
Gorai.008G047800.2Gorai.008G047800.1Gorai.009G157700.1Gorai.004G282300.2.365.445Gorai.009G443100.1
Gorai.004G282300.1.365.447Gorai.012G041000.2Gorai.012G041000.1Gorai.010G078300.1.366.448Gorai.001G192500.1
Gorai.001G204900.2.463.541Gorai.001G204900.1.463.544Gorai.002G174100.2.361.438Gorai.010G188600.1Gorai.005G159100.2.361.442
Gorai.005G159100.1.361.442Gorai.004G094500.1.361.442Gorai.010G126400.5.362.443Gorai.010G126400.4.326.407Gorai.010G126400.3.326.407
Gorai.010G126400.2.362.443Gorai.010G126400.1.362.443Gorai.008G198500.2Gorai.008G198500.1Gorai.001G093900.1
Gorai.011G159900.1Gorai.005G131400.1Gorai.001G214500.1Gorai.007G309000.3Gorai.007G309000.2
Gorai.007G309000.1Gorai.007G309000.5Gorai.007G309000.4
Linum usitatissimumLus10012937.297.379Lus10003803Lus10032601Lus10034987.303.385Lus10038529
Lus10023276Lus10020765Lus10007342Lus10031456.389.470Lus10002466
Lus10015151.388.471Lus10004391.370.452Lus10001516Lus10018306.381.463Lus10031443
Lus10040600.377.459Lus10034607.328.409Lus10032562.368.451Lus10012324Lus10004044.372.453
Lus10002295.372.453Lus10013465.362.443Lus10007929.328.409Lus10039179.383.464Lus10013758.327.404
Lus10010478Lus10004600Lus10004546Lus10038801Lus10039059
Lus10001167Lus10015259Lus10025379Lus10001764Lus10000278
Lus10002193Lus10039907
Malus domesticaMDP0000258920MDP0000905924MDP0000824147MDP0000193664MDP0000660874.390.473
MDP0000171994MDP0000299794MDP0000232219.447.529MDP0000630545.371.451MDP0000189637
MDP0000759591.375.453MDP0000295562.375.453MDP0000153096MDP0000646125.377.460MDP0000311086
MDP0000302259.282.364MDP0000120761.362.441MDP0000271262.362.438MDP0000251002.620.696MDP0000319911.615.691
MDP0000306824MDP0000258077MDP0000923219MDP0000319928MDP0000132451
MDP0000134087MDP0000528781MDP0000250892MDP0000495405MDP0000149001
MDP0000238659MDP0000166019MDP0000134605MDP0000261512MDP0000508660
MDP0000208614MDP0000128656MDP0000325237MDP0000258481MDP0000321326.481.540
Manihot esculentacassava4.1_015507mcassava4.1_031687mcassava4.1_030523m.360.441cassava4.1_016834mcassava4.1_021465m.388.469
cassava4.1_031379mcassava4.1_008433m.333.415cassava4.1_006972m.381.464cassava4.1_006981m.381.464cassava4.1_006863m.385.468
cassava4.1_007224m.326.407cassava4.1_027486mcassava4.1_017684mcassava4.1_030559mcassava4.1_007073m.366.445
cassava4.1_008277m.291.373cassava4.1_007423m.366.448cassava4.1_004064mcassava4.1_021203mcassava4.1_026286m
cassava4.1_005968m.374.456cassava4.1_032460mcassava4.1_005970m.370.451cassava4.1_006180m.361.443cassava4.1_032359m
cassava4.1_007097m.328.409cassava4.1_006189m.362.443cassava4.1_017504mcassava4.1_016895mcassava4.1_012088m
cassava4.1_006171mcassava4.1_019505m
Medicago truncatulaMedtr5g015720.1.329.412Medtr8g085390.1Medtr8g085440.1Medtr4g132280.1.383.465Medtr5g091650.1
Medtr5g078200.1.361.442Medtr3g083580.1.363.444Medtr5g085580.1.382.465Medtr8g089400.1Medtr3g048280.1
Medtr8g102340.1.334.412Medtr3g065460.1.362.440Medtr8g085720.1.365.446Medtr7g111600.1Medtr5g097420.1
Medtr4g133730.1.28.108Medtr4g133730.1.28.108Medtr4g133730.1.113.196Medtr4g133730.1.113.196Medtr3g082080.1
Medtr4g079530.1AC233675_25.1Medtr2g049670.1Medtr1g116870.1Medtr8g088120.1
Medtr8g085400.1Medtr6g090590.1.334.417
Mimulus guttatusmgv1a024473mmgv1a018942mmgv1a013772mmgv1a018824mmgv1a019800m
mgv1a014620mmgv1a019020mmgv1a011031mmgv1a004953m.369.450mgv1a005776m.382.465
mgv1a005917m.377.460mgv1a005896m.378.460mgv1a006342m.369.446mgv1a016537mmgv1a007544m
mgv1a008915mmgv1a005031m.372.454mgv1a026756mmgv1a005128m.361.442mgv1a004989m.362.443
mgv1a023060mmgv1a014915m
Oryza sativaLOC_Os02g53200.2.400.483LOC_Os02g53200.1.425.508LOC_Os05g50490.2LOC_Os05g50490.1LOC_Os01g53750.1.363.445
LOC_Os07g32600.1.393.474LOC_Os05g50490.3LOC_Os07g32600.2.393.471LOC_Os07g35350.3.377.451LOC_Os07g35350.2.377.457
LOC_Os07g35350.2.377.457LOC_Os07g35350.1.378.458LOC_Os07g35350.1.378.458LOC_Os08g14700.1.381.459LOC_Os08g14700.1.381.459
LOC_Os03g61780.2LOC_Os03g61780.1LOC_Os03g12140.3.332.413LOC_Os03g12140.2.332.413LOC_Os03g12140.1.365.446
LOC_Os07g35350.2.463.544LOC_Os07g35350.2.463.544LOC_Os07g35350.1.464.545LOC_Os07g35350.1.464.545LOC_Os07g35510.1.468.549
LOC_Os07g35510.1.468.549LOC_Os08g14700.1.467.548LOC_Os08g14700.1.467.548LOC_Os07g35560.3.330.410LOC_Os07g35560.3.330.410
LOC_Os07g35560.2.384.464LOC_Os07g35560.2.384.464LOC_Os07g35560.1.428.508LOC_Os07g35560.1.428.508LOC_Os01g44090.1
LOC_Os07g35510.1.382.460LOC_Os07g35510.1.382.460LOC_Os07g38930.5.370.451LOC_Os07g38930.4.370.451LOC_Os07g38930.3.370.451
LOC_Os07g38930.2.370.451LOC_Os07g38930.1.370.451LOC_Os03g25790.2.267.348LOC_Os03g25790.1.267.348LOC_Os06g34660.1
LOC_Os07g35480.3.379.459LOC_Os07g35480.3.379.459LOC_Os07g35480.2.379.459LOC_Os07g35480.2.379.459LOC_Os07g35480.1.379.459
LOC_Os07g35480.1.379.459LOC_Os07g35560.3.416.497LOC_Os07g35560.3.416.497LOC_Os07g35560.2.470.551LOC_Os07g35560.2.470.551
LOC_Os07g35560.1.514.595LOC_Os07g35560.1.514.595LOC_Os07g35520.1.382.462LOC_Os07g35520.1.382.462LOC_Os07g35480.3.465.546
LOC_Os07g35480.3.465.546LOC_Os07g35480.2.465.546LOC_Os07g35480.2.465.546LOC_Os07g35480.1.465.546LOC_Os07g35480.1.465.546
LOC_Os10g20650.2LOC_Os10g20650.1LOC_Os03g54910.1LOC_Os06g45450.1LOC_Os07g40940.1
LOC_Os01g55820.1LOC_Os02g29980.1LOC_Os03g30830.1LOC_Os07g43940.2LOC_Os07g43940.1
LOC_Os05g43690.1LOC_Os07g35520.1.468.549LOC_Os07g35520.1.468.549
Panicum virgatumPavirv00012973mPavirv00021112mPavirv00021949mPavirv00007493mPavirv00031700m
Pavirv00037506mPavirv00042983mPavirv00002396mPavirv00025864mPavirv00002452m.396.478
Pavirv00038260mPavirv00031106mPavirv00016071m.396.474Pavirv00038174mPavirv00058553m.353.435
Pavirv00068281m.392.473Pavirv00014937m.392.473Pavirv00013502m.383.463Pavirv00023750m.365.446Pavirv00064428m.257.339
Pavirv00038624mPavirv00016747mPavirv00011070m.342.423Pavirv00007299m.283.363Pavirv00007299m.283.363
Pavirv00007299m.283.363Pavirv00007299m.207.281Pavirv00007299m.207.281Pavirv00007299m.207.281Pavirv00025441m
Pavirv00047870mPavirv00043118m.359.433Pavirv00007299m.369.450Pavirv00007299m.369.450Pavirv00007299m.369.450
Pavirv00062581m.364.445Pavirv00010764m.364.445Pavirv00010969m.225.306Pavirv00040058m.181.262Pavirv00064003m
Pavirv00052890m.346.427Pavirv00016492mPavirv00055474m.362.442Pavirv00055474m.362.442Pavirv00055474m.448.529
Pavirv00055474m.448.529Pavirv00069751mPavirv00059376m
Physcomitrella patensPp1s51_57V6.2.428.507Pp1s6_62V6.1.412.494Pp1s6_62V6.2.412.490Pp1s138_47V6.2.405.487Pp1s138_47V6.1.405.487
Pp1s98_31V6.1.368.450Pp1s12_287V6.1Pp1s218_3V6.2.412.495Pp1s218_3V6.1.412.495Pp1s85_128V6.1.412.491
Pp1s301_24V6.1Pp1s132_136V6.1Pp1s270_88V6.4.415.498Pp1s270_88V6.3.435.518Pp1s270_88V6.2.435.518
Pp1s270_88V6.1.415.498Pp1s389_50V6.1.308.390Pp1s312_32V6.1.385.463Pp1s325_5V6.1.209.289
Phaseolus vulgarisPhvul.001G222500.1Phvul.006G003800.1Phvul.009G213600.1Phvul.001G268000.1Phvul.003G290700.1
Phvul.006G149100.2.373.454Phvul.006G149100.1.373.454Phvul.002G011900.1.315.397Phvul.001G230000.1.361.442Phvul.008G236700.1.361.442
Phvul.008G213400.1.385.468Phvul.001G056400.1.365.446Phvul.003G079900.1.382.463Phvul.008G231700.1Phvul.011G117000.1
Phvul.006G032800.1Phvul.005G097600.1Phvul.003G290300.1Phvul.002G236300.2.362.443Phvul.002G236300.1.362.443
Phvul.004G077000.1.360.441Phvul.002G245200.2Phvul.002G245200.1Phvul.002G319500.1.363.444Phvul.002G252400.1
Phvul.002G307800.1.366.448Phvul.007G204400.1Phvul.008G271000.1.378.461Phvul.008G285900.1Phvul.003G085200.1
Phvul.005G048800.1
Picea abiesMA_158566g0010MA_8603g0010.396.478MA_41265g0010MA_9241891g0010.422.503MA_5039622g0010
MA_51690g0010.372.454MA_939354g0010MA_962758g0010MA_10436589g0010.415.496MA_10429783g0010.319.400
MA_10213520g0010MA_9796357g0010MA_210389g0010MA_10427115g0010MA_90526g0010.383.465
MA_8718849g0010MA_17470g0010.395.480MA_7353g0010.523.604MA_90526g0020
Populus trichocarpaPotri.013G003500.2Potri.017G055700.1Potri.001G315700.2Potri.001G315700.1Potri.011G006100.1.383.464
Potri.004G010500.2.383.464Potri.004G010500.1.383.464Potri.006G008200.3Potri.006G008200.2Potri.002G224600.3.382.465
Potri.002G224600.2.382.465Potri.002G224600.1.365.448Potri.014G158400.2.382.464Potri.011G094400.2.388.471Potri.011G094400.1.388.471
Potri.002G224600.4.382.460Potri.014G158400.1.382.460Potri.001G353400.2Potri.001G353400.1Potri.001G006500.2.357.439
Potri.001G006500.1.357.439Potri.003G218500.4.357.439Potri.003G218500.2.357.439Potri.003G218500.1.357.439Potri.011G078500.2
Potri.019G012000.1Potri.019G007800.1Potri.011G078500.1Potri.018G068600.1.367.449Potri.014G164600.2
Potri.014G164600.1Potri.007G111000.1Potri.002G059600.1Potri.017G130200.3.347.428Potri.017G130200.2.369.450
Potri.017G130200.1.369.450Potri.006G016800.1Potri.004G086400.3.355.436Potri.004G086400.2.328.409Potri.004G086400.1.369.450
Potri.008G133200.2.328.409Potri.008G133200.1.361.442Potri.010G108500.4.328.409Potri.010G108500.3.328.409Potri.010G108500.2.344.425
Potri.010G108500.1.361.442Potri.005G202400.2Potri.005G202400.1Potri.008G082900.1Potri.010G173500.1
Potri.008G082900.2Potri.016G008900.1Potri.013G003500.1Potri.006G008200.1Potri.019G091500.2
Potri.019G091500.1Potri.013G119500.3Potri.013G119500.2Potri.013G119500.1Potri.005G003500.2
Potri.005G003500.1
Prunus persicappa026075mppa003984m.390.471ppa024163mppa004534m.369.450ppa005210m.384.467
ppa005206m.384.467ppa020432m.349.426ppa1027206m.366.448ppa019395mppa017726m
ppa020813mppa005356m.328.409ppa004732m.362.444ppa002843mppa025080m
ppa026978mppa024492mppa022594mppa010695m
Ricinus communis29724.m00083930125.m00125529904.m00293729842.m003579.388.46929005.m000260.372.453
29661.m000910.335.41530084.m000179.302.38329948.m000713.381.45929693.m00207129932.m000600
29692.m000518.361.44229762.m000502.384.46729826.m00076329597.m00029529912.m005363.367.449
29646.m00110330128.m008973
Setaria italicaSi017666m.262.344Si017035m.401.483Si017686m.262.342Si017685m.262.342Si017681m.262.342
Si023035mSi029448m.389.470Si000583m.536.618Si000582m.536.618Si031358m
Si039775mSi000908m.379.457Si000908m.379.457Si002288mSi001233m.392.469
Si000941m.370.450Si000941m.370.450Si035561m.329.410Si000851m.463.544Si000851m.463.544
Si000851m.377.454Si000851m.377.454Si029628m.364.445Si002346mSi035574m.248.329
Si035572m.248.329Si008520mSi031088mSi031085mSi031083m
Si030973mSi008713mSi036391mSi033221mSi012153m
Si037764mSi031201mSi034773mSi029616m.392.473Si003038m
Si000908m.464.545Si000908m.464.545Si000941m.453.534Si000941m.453.534Si032661m
Selaginella moellendorffii413735.452.53129014442025.353.43576256.333.41028916
75479.348.42896745.356.436402967.358.44059691413731
79527.359.43779013.338.416
Sorghum bicolorSb09g029700.1Sb04g034530.1.403.485Sb03g034100.1.367.449Sb02g032805.1Sb05g002745.1
Sb01g034190.1.223.304Sb02g035520.1.400.480Sb02g035520.1.400.480Sb02g035520.1.400.480Sb02g035480.1.396.477
Sb02g002990.1Sb02g035460.4.384.461Sb02g035460.3.384.461Sb02g035460.2.384.464Sb02g035460.2.384.464
Sb02g035460.1.384.464Sb02g035460.1.384.464Sb01g002540.1Sb02g035490.1.393.473Sb02g035490.1.393.473
Sb01g042560.1.365.446Sb02g035520.1.574.655Sb02g035520.1.574.655Sb02g035520.1.574.655Sb02g037380.1.364.445
Sb02g040340.1Sb03g028790.1Sb10g021130.1Sb02g035460.1.470.549Sb02g035460.1.470.549
Sb02g035460.2.470.551Sb02g035460.2.470.551Sb06g028225.1Sb03g035410.1Sb04g020230.1
Sb01g032330.1Sb02g035490.1.479.560Sb02g035490.1.479.560Sb02g038510.1Sb02g035520.1.488.568
Sb02g035520.1.488.568Sb02g035520.1.488.568Sb09g025330.1
Thellungiella halophilaThhalv10017202mThhalv10019651mThhalv10026599mThhalv10006713m.387.468Thhalv10004376m
Thhalv10018427m.373.454Thhalv10020572m.357.438Thhalv10020571m.357.438Thhalv10020570m.357.438Thhalv10026799m.373.456
Thhalv10004099m.344.425Thhalv10004013m.377.458Thhalv10004286m.344.421Thhalv10008261mThhalv10024870m.394.476
Thhalv10002515m.381.464Thhalv10029156mThhalv10013309m.369.451Thhalv10002820mThhalv10013478m.373.456
Thhalv10005149mThhalv10003112mThhalv10008139mThhalv10006265mThhalv10006312m
Vitis viniferaGSVIVT01021055001GSVIVT01012711001.385.466GSVIVT01036726001GSVIVT01000128001.270.352GSVIVT01030503001.267.350
GSVIVT01031317001GSVIVT01015282001.365.447GSVIVT01037711001.383.466GSVIVT01030060001GSVIVT01021583001
GSVIVT01030716001.360.441GSVIVT01011682001.361.443GSVIVT01025431001.218.299GSVIVT01021386001GSVIVT01020664001
GSVIVT01015894001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)