y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra034832
FamilyGT41
Protein PropertiesLength: 915 Molecular Weight: 101470 Isoelectric Point: 5.9917
ChromosomeChromosome/Scaffold: 05 Start: 21632100 End: 21636515
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413588490
  IKPNFAQSLNNLGVVYTVQGKMDAAASMIEKAILANPTYAEAFNNLGVLYRDAGNITAAIDAYEECLKIDPDSRNAGQNRLLAMNYINEGLDDKLYEAHR
  DWGWRFTRLHPQYTSWDNLKDPDRPIIIGYISPDFFTHSVSYFIEAPLTHHDYTKYKVVVYSAVVKADAKTFRFRDKVLKQVGVWKDIYGIDEKKIASMV
  REDKIDILVELTGHTANNKLGTMACRPAPLQVTWIGYPNTTGLPTVDYRITDSLADPPDTKQKQVEELVRLPECFLCYTPSPEAGPVCPTPALSNGFVTF
  GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSIRQRFLTTLEQLGLESKRVDLLPLILFNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMG
  VPCVTMAGSVHAHNVGVSLLSKVGLGHLVAKDEDEYVQLSVDLASDVTALSKLRMSLRDLMAGSPVCNGPSFAVALESAYRNMWRKYCKGEV
Full Sequence
Protein Sequence     Length: 915     Download
MVGIEDNTER ERSPAVENGF ANGSRSSPTT EVLSPTPKAT QGNNDTLSYA NILRARNKFT    60
DALALYETIL EKDCKNVEAH IGKGICLQTQ NKGNLAFDCF SEAIRLDPGN ACALTHCGIL    120
HKEEGRLVEA AESYQKALMA DASYKPAAEC LAIVLTDLGT SLKLAGNTQE GIQKYYEALK    180
IDPRYAPAYY NLGVVYSEMM QYDSALGCYE KAALERPMYA EAYCNMGVIY KNRGDLEMAI    240
TCYERCLAVS PNFEIAKNNM AIALTDLGTK VKLEGDVSQG VAYYKKALYY NWHYADAMYN    300
LGVAYGEMLK FDMAIVFYEL AFHFNPHCAE ACNNLGVLYK DRDNLDKAVE CYQMALSIKP    360
NFAQSLNNLG VVYTVQGKMD AAASMIEKAI LANPTYAEAF NNLGVLYRDA GNITAAIDAY    420
EECLKIDPDS RNAGQNRLLA MNYINEGLDD KLYEAHRDWG WRFTRLHPQY TSWDNLKDPD    480
RPIIIGYISP DFFTHSVSYF IEAPLTHHDY TKYKVVVYSA VVKADAKTFR FRDKVLKQVG    540
VWKDIYGIDE KKIASMVRED KIDILVELTG HTANNKLGTM ACRPAPLQVT WIGYPNTTGL    600
PTVDYRITDS LADPPDTKQK QVEELVRLPE CFLCYTPSPE AGPVCPTPAL SNGFVTFGSF    660
NNLAKITPKV LQVWARILCA VPNSRLVVKC KPFCCDSIRQ RFLTTLEQLG LESKRVDLLP    720
LILFNHDHMQ AYSLMDISLD TFPYAGTTTT CESLYMGVPC VTMAGSVHAH NVGVSLLSKV    780
GLGHLVAKDE DEYVQLSVDL ASDVTALSKL RMSLRDLMAG SPVCNGPSFA VALESAYRNM    840
WRKYCKGEVP SLRRMEMLQR EVQEDPSISK ELGSSRLNVT GEATPSLKAN GSAPVPSSLP    900
TQSSQLSKRM DSTS*                                                     960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02917PEP_TPR_lipo6.0e-1950425407+
TIGR02917PEP_TPR_lipo2.0e-1933451454+
TIGR02917PEP_TPR_lipo9.0e-2547429418+
COG3914Spy7.0e-88312844562+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAX46402.101090412910putative SPINDLY protein [Rosa luciae]
RefSeqNP_187761.1019141914SPY (SPINDLY); protein N-acetylglucosaminyltransferase/ protein binding / transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002281883.101090412907PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323412.101090012908predicted protein [Populus trichocarpa]
RefSeqXP_002530535.101090512912o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D3e-362616339386A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB4gz6_D4e-23655850524715A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB4gz6_D1e-171082646155A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB4gz6_D0.00000000000000815530212152A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB4gz6_D0.00000002371932152A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2954084014258220
GT0417893373406760
GT0417891091672730.0000000000001
GT0417891252313530.00001
GT041789616427020.59
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)