y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra035508
FamilyGH1
Protein PropertiesLength: 136 Molecular Weight: 15826.9 Isoelectric Point: 7.6438
ChromosomeChromosome/Scaffold: 08 Start: 7963981 End: 7965569
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1141307.49975e-42
  AAMNVYSEGLRNLLKYIKDNYANPEIMIMENGYGEELGATDSIKNGTADHNRKYYLQRHLLSMHEAICIDKVNVTGYFIWSLLDNFEWQDGYKNRFGLYY
  IDFKNNLTRHEKETAKY
Full Sequence
Protein Sequence     Length: 136     Download
MYKTKGIGSQ PFTAAMNVYS EGLRNLLKYI KDNYANPEIM IMENGYGEEL GATDSIKNGT    60
ADHNRKYYLQ RHLLSMHEAI CIDKVNVTGY FIWSLLDNFE WQDGYKNRFG LYYIDFKNNL    120
TRHEKETAKY IIKDS*                                                    180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01233lacG6.0e-1617130116+
PRK13511PRK135112.0e-222130139+
COG2723BglB1.0e-2417125110+
TIGR03356BGL5.0e-3118130114+
pfam00232Glyco_hydro_17.0e-3418130114+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB38783.106130382506beta-glucosidase [Arabidopsis thaliana]
DDBJBAD94012.10613067191thioglucosidase 3D precursor [Arabidopsis thaliana]
DDBJBAH20034.106130381505AT3G09260 [Arabidopsis thaliana]
EMBLCAA61592.106130381505thioglucoside glucohydrolase [Arabidopsis thaliana]
RefSeqNP_187537.106130381505PYK10; beta-glucosidase/ copper ion binding / fucosidase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cbg_A1e-275131359484A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_B2e-277133376501A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_A2e-277133376501A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_B2e-277133376501A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_A2e-277133376501A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN77897612471300
AV54348512561300
AV53736912561300
AV54391912561300
AV54630312561300
Orthologous Group
SpeciesID
Brassica rapaBra029756
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny