y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrassica rapa
Cazyme IDBra040646
FamilyGT65
Protein PropertiesLength: 340 Molecular Weight: 39034.7 Isoelectric Point: 8.7993
ChromosomeChromosome/Scaffold: 000229 Start: 37724 End: 38743
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT651999.4e-26
  MNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQFQRFNSLCKGFVRLARFSDVRNRTHSFDLEKGSGRRWTVERDLQQLKQSATNEFEVVRVVGKNPFLW
GT65992830
  WHDHWPVKDYAKVFECMVVVDEISREADKVVTRIRQGGGDNRIRTGLVPFVAVHMRIEIDWMIHCKKLEQRLKVSEICSSKREIMERVGNISGLKTPTVL
  YLAVADSLLDEKDEESSVLNGWRDGLVPYEKKKLGVKEEVYGKYSYLIQSAIDYEVCLRADVFVGNSFSTFSSLIVLERTQKMRR
Full Sequence
Protein Sequence     Length: 340     Download
MNRTLLMPSL SASLFYKEVD KLRPIPFDKV FQFQRFNSLC KGFVRLARFS DVRNRTHSFD    60
LEKGSGRRWT VERDLQQLKQ SATNEFEVVR VVGKNPFLWH DHWPVKDYAK VFECMVVVDE    120
ISREADKVVT RIRQGGGDNR IRTGLVPFVA VHMRIEIDWM IHCKKLEQRL KVSEICSSKR    180
EIMERVGNIS GLKTPTVLYL AVADSLLDEK DEESSVLNGW RDGLVPYEKK KLGVKEEVYG    240
KYSYLIQSAI DYEVCLRADV FVGNSFSTFS SLIVLERTQK MRRLGFVSSC EDGENEWRSY    300
AYNLAGESKG VPRRWMTNMT HSSLEAISYG SSSVSCSSE*                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11302O-FucT-19.0e-5119277179+
cd11299O-FucT_plant1.0e-121278306+
cd11296O-FucT_like3.0e-27101282185+
pfam10250O-FucT2.0e-431278309+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN72045.1013382350unknown protein [Arabidopsis thaliana]
RefSeqNP_187183.30133896444unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10133682427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.1013362347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.1013362347predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.000002147277212344A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3zy5_A0.000002147277212344A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3zy4_A0.000002147277212344A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3zy3_B0.000002147277212344A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3zy3_A0.000002147277212344A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX776897234943270
DW517470260843270
FD5479482081203270
DW517397253843200
EE46543215611560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny