y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g03660.1
FamilyGT2
Protein PropertiesLength: 352 Molecular Weight: 38917.5 Isoelectric Point: 9.3197
ChromosomeChromosome/Scaffold: 1 Start: 2462619 End: 2466016
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2862815.3e-33
  SLIVPAYNEECRLPEALTETFNYLKQRSTADKSFSYEVLIVDDGSTDCTSKVAFGYVKKHKIDNVRVLLLGRNHGKGEAVRKGMLHSRGELLLMLDADGA
  TKITDLEKLEAQVRALAKKADSSLAPSATSSQRLSDVEIAVFGSRAHLEKEALATRKWYRNFLMKGFHLVVLLTAGPGIRDTQCGFKMFTRSAARK
Full Sequence
Protein Sequence     Length: 352     Download
MAGAAWTLSS AADLLPASLS LSLLLASLVA ILVLGVAAVL FDHLRKIGCM HSLERTSVSD    60
AFFEDPSSLN KVPCPSIFDP AEKYISLIVP AYNEECRLPE ALTETFNYLK QRSTADKSFS    120
YEVLIVDDGS TDCTSKVAFG YVKKHKIDNV RVLLLGRNHG KGEAVRKGML HSRGELLLML    180
DADGATKITD LEKLEAQVRA LAKKADSSLA PSATSSQRLS DVEIAVFGSR AHLEKEALAT    240
RKWYRNFLMK GFHLVVLLTA GPGIRDTQCG FKMFTRSAAR KLFTNIRLKR WCFDVEIVYL    300
CKHLRIPMAE VSVSWTEIPG SKVRMTSILH MVFELLLIKV GYGLGIWKIY S*            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06442DPM1_like9.0e-2187335257+
pfam00535Glycos_transf_22.0e-2286283198+
cd04179DPM_DPG-synthase_like5.0e-5087301215+
PTZ00260PTZ002601.0e-10077349277+
cd04188DPG_synthase3.0e-10387322236+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAO18453.104235171380putative dolichyl-phosphate beta-glucosyltransferase [Oryza sativa Japonica Group]
GenBankEEC76428.1013511352hypothetical protein OsI_14108 [Oryza sativa Indica Group]
RefSeqNP_001051729.1013511352Os03g0821800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001140935.104235141350hypothetical protein LOC100273013 [Zea mays]
RefSeqXP_002530857.105934942333Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3l7m_D0.00285184494A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7m_C0.00285184494A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7m_B0.00285184494A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7m_A0.00285184494A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7l_D0.00285184494A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesis2.4.1.117-RXNEC-2.4.1.117dolichyl-phosphate β-glucosyltransferase
Transmembrane Domains
StartEnd
1941
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG875400261923520
HO335835240953340
HO323954235642980
CV768682254553080
DV712496279633400
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00165.2Aquca_011_00165.3Aquca_011_00165.4Aquca_011_00165.1
Arabidopsis lyrata482983
Arabidopsis thalianaAT2G39630.2AT2G39630.1
Brassica rapaBra005029Bra000139
Carica papayaevm.model.supercontig_1.403
Capsella rubellaCarubv10023563m
Chlamydomonas reinhardtiiCre16.g652850.t1.2
Citrus clementinaCiclev10032053m
Citrus sinensisorange1.1g027065morange1.1g019818morange1.1g023346m
Cucumis sativusCucsa.010820.1Cucsa.165370.1Cucsa.165370.2Cucsa.165370.3
Eucalyptus grandisEucgr.G02933.1Eucgr.G02933.2Eucgr.G02933.3
Fragaria vescamrna26609.1-v1.0-hybrid
Glycine maxGlyma02g10150.1Glyma18g52810.2Glyma18g52810.1Glyma02g10150.3Glyma02g10150.2
Gossypium raimondiiGorai.011G260700.2Gorai.009G319400.2Gorai.009G319400.4Gorai.011G260700.3Gorai.011G260700.1
Gorai.009G319400.1Gorai.009G319400.3
Linum usitatissimumLus10005164Lus10001691Lus10023414Lus10040296
Malus domesticaMDP0000274007MDP0000272852
Manihot esculentacassava4.1_011328m
Medicago truncatulaMedtr7g026260.2Medtr7g026260.1
Mimulus guttatusmgv1a025143m
Oryza sativaLOC_Os03g60700.1LOC_Os03g60700.2
Panicum virgatumPavirv00060983mPavirv00063183m
Physcomitrella patensPp1s49_46V6.1Pp1s14_205V6.2Pp1s14_205V6.1Pp1s96_201V6.1
Phaseolus vulgarisPhvul.008G010800.1Phvul.008G010800.2
Picea abiesMA_10347707g0010MA_10428813g0010MA_159008g0490MA_158860g0090
Populus trichocarpaPotri.010G204000.4Potri.010G204000.2Potri.010G204000.1Potri.008G055700.1Potri.010G204000.3
Potri.008G055700.2
Prunus persicappa008313m
Ricinus communis30003.m000334
Setaria italicaSi036396m
Selaginella moellendorffii73379414988101926
Sorghum bicolorSb01g003140.1
Thellungiella halophilaThhalv10016901m
Vitis viniferaGSVIVT01016551001
Volvox carteriVocar20012273m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny