y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g04640.1
FamilyGH28
Protein PropertiesLength: 289 Molecular Weight: 31137.2 Isoelectric Point: 8.6339
ChromosomeChromosome/Scaffold: 1 Start: 3112631 End: 3113751
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH282112841.3e-24
  DVQLYGTTNGARIKTYQGGSGYAKDIVFQNIIIDNVQNPIIIDQNYCDSAKPCENQESAVEISNVVFKNIRGTT
GH28502179.94922e-44
  WTAACSSSRPAVLLVPKGKTYLLKSITLSGPCKSNLVFMVKGTLAAPRSLSDWSEENRRHWIVLHGINGLTVTGGGTINGNGELWWKNSCKTNKARPCKQ
  APTALTFHLCSNLTVENLKIVNSQQINMSVEDCSDVQLARLSITAPGTSPNTDGIHITRSKDVQLYGT
Full Sequence
Protein Sequence     Length: 289     Download
MASTTAKLEP CMFSTSNASS VNTSVEFSID NYGARGDGKR DDTEALAKAW TAACSSSRPA    60
VLLVPKGKTY LLKSITLSGP CKSNLVFMVK GTLAAPRSLS DWSEENRRHW IVLHGINGLT    120
VTGGGTINGN GELWWKNSCK TNKARPCKQA PTALTFHLCS NLTVENLKIV NSQQINMSVE    180
DCSDVQLARL SITAPGTSPN TDGIHITRSK DVQLYGTTNG ARIKTYQGGS GYAKDIVFQN    240
IIIDNVQNPI IIDQNYCDSA KPCENQESAV EISNVVFKNI RGTTVSRV*                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03003PLN030031.0e-3027286321+
pfam00295Glyco_hydro_288.0e-3554218165+
PLN02188PLN021885.0e-3627288326+
PLN02218PLN022184.0e-6728288321+
PLN02793PLN027931.0e-6827287319+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC57273.102528751371putative polygalacturonase PG1 [Oryza sativa Japonica Group]
GenBankEAZ03178.102528751366hypothetical protein OsI_25331 [Oryza sativa Indica Group]
GenBankEAZ39077.102528751371hypothetical protein OsJ_23509 [Oryza sativa Japonica Group]
RefSeqXP_002463688.102728762380hypothetical protein SORBIDRAFT_01g004230 [Sorghum bicolor]
RefSeqXP_002466242.102728775394hypothetical protein SORBIDRAFT_01g004220 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3jur_D0.00000052620427241A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C0.00000052620427241A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B0.00000052620427241A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A0.00000052620427241A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1bhe_A0.00003121280113304A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2103EC-3.2.1.15polygalacturonase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR809446188272140
DV536718188272140
DV514791188272140
BG365247178272030
DV028222193272140
Orthologous Group
SpeciesID
Brachypodium distachyonBradi1g04640.1.50.217Bradi1g04640.1.50.217
Citrus sinensisorange1.1g042447morange1.1g039868m.44.127orange1.1g039868m.44.127
Picea abiesMA_10862g0010MA_10426591g0010
Selaginella moellendorffii102892113633.59.225113633.59.225
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny