y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g08070.1
FamilyGT35
Protein PropertiesLength: 979 Molecular Weight: 109258 Isoelectric Point: 5.3575
ChromosomeChromosome/Scaffold: 1 Start: 5684232 End: 5691628
DescriptionGlycosyl transferase, family 35
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT355699720
  KSDPKLPRVVRMANLCVVGGHSVNGVAEIHSEIVKQDVFNSFYEMWPAKFQNKTNGVTPRRWIRFCNPELSAIISKWIASDEWVLNTDKLAELKKFADNE
  DLQSEWRTTKRNNKMKVVSLIRDQTGYVVSPDAMFDVQVKRIHEYKRQLLNILGIVYRYKKMKEMDAKDRIKSFVPRVCIFGGKAFATYVQAKRIVKFIT
  DVAATVNHDPDIGDLLKVVFVPDYNVSVAETLIPASELSQHISTAGMEASGTSNMKFSMNGCILIGTLDGANVEIREEVGEENFFLFGAEAPEIAGLRKE
  RAQGKFVPDPRFEEVKKYVRSGVFGTSNYDELMGSLEGNEGYGRADYFLVGKDFPSYIECQEKVDEAYRDQKLWTRMSILNTAGSPKFSSDRTIHEYAKD
  IWDI
GT351635250
  ALKQLGQNLEDVASQEPDPALGNGGLGRLASCFLDSLATLNYPAWGYGLRYRYGLFKQIITKDGQEEVAENWLEMGNPWEIVRNDVSYPVKFYGKVVEGT
  DGRKHWIGGENIKAVAHDVPIPGYKTKTTNNLRLWSTTVPSQDFDLGAFNAGDHAKANQAHLNAEKICHVLYPGDESSEGKVLRLKQQYTLCSASLQDII
  SRFETRAGDSLNWEDFPSKVAVQMNDTHPTLCIPELMRILIDVKGLSWNKAWSITERTVAYTNHTVLPEALEKWSLDIMQKLLPRHVEIIETIDGELMNG
  IISKYGTADISLLKQKLKEMRILDNVDLPDSIAKLFIKPKEKKESPSKSKEKLLVKSLESMAE
Full Sequence
Protein Sequence     Length: 979     Download
MATASPPLTL ATSYPPLAAA AGGGRLVVVG AGGGGVAPRR GPRGLAVRSV ASDREVQGPS    60
ASAEEELSSV LSSIDSSAIA SNIKHHAEFT PLFSPDHISP LKAYHATAKS VFDALIMNWN    120
ATYDYYNRMN VKQAYYLSME FLQGRALTNA IGNLELTGQY AEALKQLGQN LEDVASQEPD    180
PALGNGGLGR LASCFLDSLA TLNYPAWGYG LRYRYGLFKQ IITKDGQEEV AENWLEMGNP    240
WEIVRNDVSY PVKFYGKVVE GTDGRKHWIG GENIKAVAHD VPIPGYKTKT TNNLRLWSTT    300
VPSQDFDLGA FNAGDHAKAN QAHLNAEKIC HVLYPGDESS EGKVLRLKQQ YTLCSASLQD    360
IISRFETRAG DSLNWEDFPS KVAVQMNDTH PTLCIPELMR ILIDVKGLSW NKAWSITERT    420
VAYTNHTVLP EALEKWSLDI MQKLLPRHVE IIETIDGELM NGIISKYGTA DISLLKQKLK    480
EMRILDNVDL PDSIAKLFIK PKEKKESPSK SKEKLLVKSL ESMAEVEEKI ESEEEENILP    540
ETAEEKAESE EIADAEKEEP EYELDPFAKS DPKLPRVVRM ANLCVVGGHS VNGVAEIHSE    600
IVKQDVFNSF YEMWPAKFQN KTNGVTPRRW IRFCNPELSA IISKWIASDE WVLNTDKLAE    660
LKKFADNEDL QSEWRTTKRN NKMKVVSLIR DQTGYVVSPD AMFDVQVKRI HEYKRQLLNI    720
LGIVYRYKKM KEMDAKDRIK SFVPRVCIFG GKAFATYVQA KRIVKFITDV AATVNHDPDI    780
GDLLKVVFVP DYNVSVAETL IPASELSQHI STAGMEASGT SNMKFSMNGC ILIGTLDGAN    840
VEIREEVGEE NFFLFGAEAP EIAGLRKERA QGKFVPDPRF EEVKKYVRSG VFGTSNYDEL    900
MGSLEGNEGY GRADYFLVGK DFPSYIECQE KVDEAYRDQK LWTRMSILNT AGSPKFSSDR    960
TIHEYAKDIW DISPVILP*                                                 1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00343Phosphorylase1.0e-149163486325+
cd04300GT1_Glycogen_Phosphorylase0575972407+
cd04300GT1_Glycogen_Phosphorylase082487411+
pfam00343Phosphorylase0576974401+
TIGR02093P_ylase0576972402+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK15695.10489781928AF327055_1 alpha 1,4-glucan phosphorylase L isozyme [Oryza sativa]
GenBankACC59201.1019781971plastid alpha-1,4-glucan phosphorylase [Triticum aestivum]
DDBJBAG49328.1019781978plastidial starch phosphorylase 1 [Oryza sativa Japonica Group]
GenBankEEC76210.1019781964hypothetical protein OsI_13605 [Oryza sativa Indica Group]
GenBankEEE59962.1019781977hypothetical protein OsJ_12655 [Oryza sativa Japonica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2azd_B0578970404792A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
PDB2azd_B013045657375A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
PDB2azd_A0578970404792A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
PDB2azd_A013045657375A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
PDB2aw3_B0578970404792A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1826EC-2.4.1.1phosphorylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7971784015799790
HO7783034015799790
HO7783033971034990
HO6207674035779790
HO6139544035779790
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)