y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g12030.1
FamilyGT14
Protein PropertiesLength: 453 Molecular Weight: 48931.6 Isoelectric Point: 6.5151
ChromosomeChromosome/Scaffold: 1 Start: 8936927 End: 8939287
DescriptionCore-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT14573180
  FAYLISGSAGDAAMLRRVLLALYHPRNHYILHLDAQAPDSDRAGLAAFVASHRVLAAARNVRVVEKANLVTYRGPTMVTTTLHAAAAFLWGEGRGKGADW
  DWFVNLSASDYPLVTQDDLMDVFSGLPRGLSFIDHTSDIGWKAFARAMPMIVDPGLYMDKKDDLFWVPQKRSLPTAFKLFTGSAWMVLSKPFVEYLIWGW
  DNLPRTVLLYYANFISSPEGYFHTVACNAEEFRNTTVNSDLHYIAWDNPPMQHPHLLTLADW
Full Sequence
Protein Sequence     Length: 453     Download
MESAAPSPLR WVLSVAAGGL FALFLLLASS SIPFPSTSLF FTPTTPASPS PPPPPRFAYL    60
ISGSAGDAAM LRRVLLALYH PRNHYILHLD AQAPDSDRAG LAAFVASHRV LAAARNVRVV    120
EKANLVTYRG PTMVTTTLHA AAAFLWGEGR GKGADWDWFV NLSASDYPLV TQDDLMDVFS    180
GLPRGLSFID HTSDIGWKAF ARAMPMIVDP GLYMDKKDDL FWVPQKRSLP TAFKLFTGSA    240
WMVLSKPFVE YLIWGWDNLP RTVLLYYANF ISSPEGYFHT VACNAEEFRN TTVNSDLHYI    300
AWDNPPMQHP HLLTLADWDG MVGSEAPFAR KFRRDDPVLD RIDADLLSRA PGSLAPGGWC    360
RSAAAAGEGE GEGRSGGAGE SNNRTGGGED PCTAVGDAAL LRPGPGAARL RRLVSSLLSE    420
ENFRPKQCKL VEPVAAADDK KKDVGQSSDG GA*                                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02485Branch3.0e-6658322269+
PLN03183PLN031834.0e-17258429372+
Gene Ontology
GO TermDescription
GO:0008375acetylglucosaminyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACO87683.104142957424b-1-3-galactosyl-o-glycosyl-glycoprotein [Brachypodium sylvaticum]
EMBLCAH10050.104142956425BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein [Triticum aestivum]
RefSeqNP_001050958.105643280447Os03g0692000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001147735.102742844449BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein [Zea mays]
RefSeqXP_002466639.105742889451hypothetical protein SORBIDRAFT_01g011480 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3otk_D0.000017027898285A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_C0.000017027898285A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_B0.000017027898285A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_A0.000017027898285A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB2gam_D0.000047027898285A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE189170279813590
DR799268270903590
EC876305267933590
EE160166261993590
EB640333261583180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_036_00138.1Aquca_033_00106.2Aquca_033_00106.1Aquca_002_00424.1Aquca_020_00132.1
Aquca_008_00038.1Aquca_010_00740.1Aquca_009_00543.1Aquca_009_00543.2Aquca_041_00146.1
Aquca_002_01158.1Aquca_034_00186.1Aquca_018_00050.1Aquca_002_01158.2
Arabidopsis lyrata478965492046474430488347887505
352501493988317250476239479931
345499
Arabidopsis thalianaAT3G15350.2AT3G15350.1AT4G27480.2AT4G27480.1AT1G53100.2
AT1G53100.1AT5G15050.1AT4G03340.1AT1G03520.2AT1G03520.1
AT5G39990.1AT3G03690.1AT2G37585.1AT1G71070.1AT3G24040.1
Brachypodium distachyonBradi2g06240.1Bradi1g36660.1Bradi4g00410.1Bradi3g14860.1Bradi3g27240.1
Bradi1g66497.1Bradi2g35570.1Bradi1g75410.1Bradi2g01620.1Bradi2g51360.1
Brassica rapaBra027260Bra021099Bra010402Bra019047Bra023502
Bra033408Bra025627Bra000835Bra019015Bra005182
Bra007960Bra003937Bra016161Bra036442Bra028365
Bra030961.71.182Bra030961.71.182Bra028449.89.200Bra028449.89.200Bra030961.183.259
Bra030961.183.259Bra028449.201.280Bra028449.201.280Bra026345
Carica papayaevm.model.supercontig_80.66evm.model.supercontig_14.55evm.model.supercontig_75.39evm.model.supercontig_34.110evm.model.supercontig_161.40
evm.model.supercontig_65.120evm.model.supercontig_1305.1evm.model.supercontig_59.74
Capsella rubellaCarubv10015665mCarubv10004902mCarubv10011618mCarubv10000991mCarubv10007491m
Carubv10009126mCarubv10000946mCarubv10000945mCarubv10015869mCarubv10023410m
Carubv10021335mCarubv10013765m
Citrus clementinaCiclev10008457mCiclev10008455mCiclev10008397mCiclev10011781mCiclev10015218m
Ciclev10012121mCiclev10020438mCiclev10015512mCiclev10015447mCiclev10004926m
Ciclev10004962mCiclev10027025mCiclev10005424m
Citrus sinensisorange1.1g015112morange1.1g015070morange1.1g014438morange1.1g037238morange1.1g013052m
orange1.1g015219morange1.1g015651morange1.1g015902morange1.1g015224morange1.1g039162m
orange1.1g016354morange1.1g012284morange1.1g014248m
Cucumis sativusCucsa.123130.1Cucsa.032560.2Cucsa.032560.1Cucsa.339150.1Cucsa.132030.1
Cucsa.147940.1Cucsa.175380.1Cucsa.069780.1Cucsa.074790.1Cucsa.283010.1
Cucsa.256110.1
Eucalyptus grandisEucgr.J02142.1Eucgr.C04217.1Eucgr.K00938.1Eucgr.A02143.1Eucgr.A02896.1
Eucgr.A01787.1Eucgr.G02200.1Eucgr.F01131.1.87.200Eucgr.F01131.1.87.200Eucgr.F01131.1.201.312
Eucgr.F01131.1.201.312Eucgr.H00106.1
Fragaria vescamrna17150.1-v1.0-hybridmrna01296.1-v1.0-hybridmrna31025.1-v1.0-hybridmrna10276.1-v1.0-hybridmrna18171.1-v1.0-hybrid
mrna18381.1-v1.0-hybridmrna20759.1-v1.0-hybridmrna05266.1-v1.0-hybridmrna01567.1-v1.0-hybrid
Glycine maxGlyma13g35180.2Glyma13g35180.1Glyma12g35330.1Glyma06g36720.1Glyma12g25250.1
Glyma13g23660.1Glyma17g12400.1Glyma06g29710.1Glyma13g05020.1Glyma04g18960.1
Glyma18g48990.1Glyma06g45200.2Glyma06g45200.1Glyma12g11780.1Glyma13g05020.2
Glyma19g02215.1Glyma18g28140.1Glyma16g03980.1Glyma19g29570.1Glyma03g19720.2
Glyma09g15890.1Glyma20g26180.1Glyma10g41085.1Glyma07g23470.1Glyma20g04810.1
Glyma09g21230.1Glyma10g25500.1Glyma12g12626.1Glyma09g37630.3Glyma07g02330.1
Glyma08g07291.1Glyma08g23690.2
Gossypium raimondiiGorai.007G323000.1Gorai.013G168800.1Gorai.002G069800.1Gorai.004G277100.1Gorai.006G025900.1
Gorai.007G078400.1Gorai.008G152300.1Gorai.002G017200.1Gorai.007G254100.1Gorai.007G375700.1
Gorai.006G025900.2Gorai.013G168800.2Gorai.002G180500.1Gorai.005G162900.1Gorai.005G039100.1
Gorai.011G162900.2Gorai.011G096300.1Gorai.011G162900.1Gorai.011G003300.1Gorai.011G003300.3
Gorai.013G168800.3Gorai.011G003300.2Gorai.011G162900.4Gorai.011G162900.3Gorai.011G096200.1
Gorai.012G103300.1Gorai.011G003300.4.64.175Gorai.011G003300.4.64.175Gorai.011G003300.4.176.237Gorai.011G003300.4.176.237
Linum usitatissimumLus10019477Lus10043324Lus10014495Lus10032189Lus10030084
Lus10001076Lus10033714Lus10031626Lus10020316Lus10005676
Lus10025339Lus10024404Lus10023687Lus10010887Lus10011765
Lus10012710Lus10033379Lus10034829Lus10032190
Malus domesticaMDP0000239687MDP0000123687MDP0000155219MDP0000282003MDP0000162834
MDP0000249209MDP0000449744MDP0000307454MDP0000267752MDP0000932170
MDP0000245544MDP0000137993MDP0000885638MDP0000270038MDP0000153023
MDP0000192952.75.186MDP0000192952.75.186MDP0000142975MDP0000272624MDP0000295443.72.183
MDP0000295443.72.183MDP0000192952.187.266MDP0000192952.187.266MDP0000295443.184.263MDP0000295443.184.263
MDP0000181360MDP0000715754MDP0000313248MDP0000313224.50.161MDP0000313224.50.161
MDP0000316002.50.161MDP0000316002.50.161MDP0000313224.162.242MDP0000313224.162.242MDP0000316002.162.241
MDP0000316002.162.241
Manihot esculentacassava4.1_021997mcassava4.1_008494mcassava4.1_008168mcassava4.1_008154mcassava4.1_008155m
cassava4.1_007790mcassava4.1_009031mcassava4.1_009098mcassava4.1_009176mcassava4.1_008034m
cassava4.1_009261mcassava4.1_009439mcassava4.1_022088m
Medicago truncatulaMedtr2g085300.1Medtr4g114140.1Medtr4g022240.1Medtr4g114380.1Medtr7g086720.1
Medtr1g108280.1Medtr6g011080.1
Mimulus guttatusmgv1a008702mmgv1a008696mmgv1a006985mmgv1a006718mmgv1a006669m
mgv1a022320mmgv1a009678mmgv1a007531mmgv1a006803mmgv1a011716m
Oryza sativaLOC_Os01g10440.1LOC_Os06g40060.1LOC_Os12g44240.1LOC_Os08g04790.1LOC_Os03g48560.1
LOC_Os10g30080.1LOC_Os03g16890.1LOC_Os01g03160.2LOC_Os01g03160.1LOC_Os04g23580.1
LOC_Os05g06050.1LOC_Os01g56570.1LOC_Os06g40060.2
Panicum virgatumPavirv00019455mPavirv00024205mPavirv00070373mPavirv00011279mPavirv00012576m
Pavirv00006497mPavirv00040685mPavirv00045020mPavirv00027503mPavirv00007501m
Pavirv00030167mPavirv00018830mPavirv00063237mPavirv00032862mPavirv00034423m
Pavirv00063189mPavirv00055573mPavirv00024965mPavirv00004851mPavirv00030168m
Pavirv00001113mPavirv00066444mPavirv00018457mPavirv00041877mPavirv00067372m
Physcomitrella patensPp1s338_21V6.1Pp1s329_26V6.1Pp1s245_39V6.1Pp1s170_74V6.1Pp1s90_77V6.1
Pp1s149_88V6.1
Phaseolus vulgarisPhvul.011G158600.1Phvul.005G071700.2Phvul.005G071700.1Phvul.003G164200.1Phvul.004G025100.1
Phvul.009G197600.1Phvul.011G112200.1Phvul.010G014000.1Phvul.001G105800.1Phvul.004G049700.1
Phvul.008G044300.1Phvul.007G037400.1Phvul.003G022600.1Phvul.008G044300.2Phvul.007G237800.1
Phvul.008G254300.1Phvul.008G030600.1
Picea abiesMA_15991g0010MA_10434286g0010MA_135415g0010MA_10270737g0010MA_9468439g0010
MA_765295g0010MA_10435892g0010MA_56251g0010MA_10236057g0010
Populus trichocarpaPotri.011G119600.3Potri.011G119600.2Potri.011G119600.1Potri.001G399500.2Potri.001G399500.1
Potri.004G130300.1Potri.017G075600.1Potri.013G145500.3Potri.013G145500.2Potri.013G145500.1
Potri.009G003300.1Potri.019G104600.2Potri.019G104600.1Potri.013G066200.2Potri.013G066200.1
Potri.006G263000.1Potri.008G128000.1Potri.010G114800.3Potri.010G114800.2Potri.008G128000.2
Potri.010G114800.1Potri.001G053800.1Potri.010G114800.4Potri.008G006500.1Potri.008G128000.3
Prunus persicappa006234mppa006230mppa006279mppa006088mppa005952m
ppa007142mppa006588mppa006761mppa006063mppa006304m
Ricinus communis27755.m00008729822.m00344929983.m00325630025.m00058230059.m000467
29904.m00301530072.m00093528320.m00112230186.m001300
Setaria italicaSi001156mSi006450mSi013663mSi035659mSi022126m
Si040241mSi035899mSi035846mSi010215mSi022136m
Si001619mSi002524mSi002523m
Selaginella moellendorffii8393274856
Sorghum bicolorSb03g002590.1Sb03g002600.1Sb10g023480.1Sb08g023170.1Sb01g011480.1
Sb01g021260.1Sb01g047240.1Sb01g039410.1Sb03g007750.1Sb07g003140.1
Sb09g004030.1Sb03g035990.1
Thellungiella halophilaThhalv10020797mThhalv10025300mThhalv10012067mThhalv10012246mThhalv10012228m
Thhalv10013590mThhalv10027776mThhalv10028669mThhalv10020953mThhalv10016783m
Thhalv10002511m
Vitis viniferaGSVIVT01014331001GSVIVT01015525001GSVIVT01020106001GSVIVT01030572001GSVIVT01011780001
GSVIVT01034191001GSVIVT01032590001GSVIVT01029033001GSVIVT01029965001GSVIVT01016621001
Zea maysAC208327.4_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)