y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g14127.1
FamilyGH85
Protein PropertiesLength: 708 Molecular Weight: 79334.4 Isoelectric Point: 5.0558
ChromosomeChromosome/Scaffold: 1 Start: 11045169 End: 11049829
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH85983790
  MQGGYRDDAAPQGGANPDAYALWHWHLMDIFVYFSHYLVTLPPPCWTNTAHLHGVKVLGTFIAEWDKGAEICREMFATQDSAQMYAERLQELAATLGFDG
  WLINIEVKLDIQFIDNLKEFVNHLTDRMHAAVPGSLVIWYDAVTVNGHLNWQNKLNEYNKPFFDLCDGLFVNYTWKENYPQDSAAVAGERKYDVYMGIDV
  FGRNSYGGGQWNTNVALDLLKKDDISTAIFAPGWIYETKQPPDFQSAQNRWWDLVEKSWGVLQSYPKRLPFYSDFDQGRGYQ
Full Sequence
Protein Sequence     Length: 708     Download
MPFTLRRFLR RLRTMISSSD NEGPVSEDDR RPWEPPFDAS KPAPPISYPI TELAALASRS    60
YLSDASNFHL PFNRASTPLP SPGAPLPPRR RVLVCHDMQG GYRDDAAPQG GANPDAYALW    120
HWHLMDIFVY FSHYLVTLPP PCWTNTAHLH GVKVLGTFIA EWDKGAEICR EMFATQDSAQ    180
MYAERLQELA ATLGFDGWLI NIEVKLDIQF IDNLKEFVNH LTDRMHAAVP GSLVIWYDAV    240
TVNGHLNWQN KLNEYNKPFF DLCDGLFVNY TWKENYPQDS AAVAGERKYD VYMGIDVFGR    300
NSYGGGQWNT NVALDLLKKD DISTAIFAPG WIYETKQPPD FQSAQNRWWD LVEKSWGVLQ    360
SYPKRLPFYS DFDQGRGYQV SSEGLQVSRD PWNNISCQSF QPMLKYTGDE VHPPLITSIN    420
FKDGQYSGGG CVTVKGGLNQ NTIFSEQLFE ASISMEDGPL HLFYSVKADT NCVVGLSLDL    480
SSRNKGNTSV LIAENIATFH RKKKNHIYST YVQSVKARAL DNQNWVLYQA TVQSCASYTM    540
TGINIVCTLG TSGNINPETE EDGSLEADAN ILSAYQASLG HISIQDIDET MPFPPLESWE    600
IEGEHISWSN SNASKLVSLK ISWKLKTSHP ATFTKYNIYV EKLTTDSIAK ASRSFMGVAS    660
VEAFYVSDLQ VPDEVTILKF IVQACGCDGS NQELEECPKF FLVPVVA*                 720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00598GH18_chitinase-like1.0e-7100262182+
COG4724COG47245.0e-33105481415+
pfam03644Glyco_hydro_857.0e-12598379301+
cd06547GH85_ENGase1.0e-12793402330+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAV43808.103070520692unknown protein [Oryza sativa Japonica Group]
GenBankEAY97626.103065934660hypothetical protein OsI_19549 [Oryza sativa Indica Group]
GenBankEEE63344.103070534706hypothetical protein OsJ_18155 [Oryza sativa Japonica Group]
RefSeqNP_001055263.10107051697Os05g0346500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002440911.102870518682hypothetical protein SORBIDRAFT_09g016230 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fha_D7e-27234795465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_C7e-27234795465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_B7e-27234795465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_A7e-27234795465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_F7e-27234795465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT8520242454567000
JG9396642882295160
CB670350245332770
EL4379372571173730
JG6212242641424040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma14g06120.2Glyma18g40011.1Glyma02g43025.1Glyma11g35630.1Glyma14g06130.1
Glyma14g06120.1Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.012G079500.1Gorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny