y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g15410.1
FamilyGT77
Protein PropertiesLength: 615 Molecular Weight: 70049.7 Isoelectric Point: 6.953
ChromosomeChromosome/Scaffold: 1 Start: 12331172 End: 12337159
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771283520
  VDNLLVGAMDTKLLRELYLRGVPVFDMGSRMVTEDAGWGSPTFHKMGREKVLLINTLLPFGYELLMCDTDMVWLKNPLPYLARYPDADLLTSSDQVIPTV
  TDDSLENWREVTGAFNIGIFHWRPTEPAKKLAKDWKDLVLSDDEIWDQNAFNDLAHKVFGQPVQGQDELVYSYDGKLKLGVLPAAIFCSGHTYFVQGMHQ
  QLHLEPYAVHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 615     Download
MAAWWCPAES TKPVFVGIFG AILGGFAVSA LFFLLSFSSL ASPPIPFPAV APTTTNVSGP    60
AQPETIYNRP IWKPPPRGSR MPPPRAFRLT RDMVRARARD GVIVVTFGNY AFLDFILTWA    120
HHLTALGVDN LLVGAMDTKL LRELYLRGVP VFDMGSRMVT EDAGWGSPTF HKMGREKVLL    180
INTLLPFGYE LLMCDTDMVW LKNPLPYLAR YPDADLLTSS DQVIPTVTDD SLENWREVTG    240
AFNIGIFHWR PTEPAKKLAK DWKDLVLSDD EIWDQNAFND LAHKVFGQPV QGQDELVYSY    300
DGKLKLGVLP AAIFCSGHTY FVQGMHQQLH LEPYAVHTTF QYAGTEGKRH RLREAMLFFD    360
PPPYYDSPGG FLSFRPSIPK KLLLDGAHTV ESHFALVNYQ MKQVRTALAI ASLLKRTLVM    420
PPLWCRLDRM WFGHPGVLEG TMTRQPFLCP MDHVFEINVM TKDLPEEEFG PHIDFREYSF    480
LENPSLPKQV KESFLEVQLC DEHSTRCSTA NGTNKHRPLI LARNSTEETL LNVFSLYKNI    540
KIIQFSSMVD AFRGFADAAV ETKFRDRVKR YVGIWCCVEL REIGHIYYDM YWDEKPGWKP    600
HPPRNREEDH PPWS*                                                     660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans3.0e-46128352231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF97349.1056134617expressed protein [Oryza sativa (japonica cultivar-group)]
GenBankEEC75649.1056134617hypothetical protein OsI_12401 [Oryza sativa Indica Group]
GenBankEEE59420.1013161371553hypothetical protein OsJ_11574 [Oryza sativa Japonica Group]
RefSeqNP_001143144.1016141615hypothetical protein LOC100275624 [Zea mays]
RefSeqXP_002464281.1016141615hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Transmembrane Domains
StartEnd
1537
101123
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX1308722951714650
EV2351133031664680
DT5119933041024050
GR7084012981144110
CB628814264573200
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)