y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g17570.1
FamilyGT8
Protein PropertiesLength: 622 Molecular Weight: 71277 Isoelectric Point: 9.5131
ChromosomeChromosome/Scaffold: 1 Start: 14122938 End: 14127150
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT82925930
  CFSMRLTLEYFKSSSLNSDVSSAHKFNTPNHKHYVILSKNVLAASVVINSTVINSKDPGNNVFHILTDAQNFYGMKYWFARNSYKKSALHVINYEETILE
  KLPKHSMREMYLPEEFRVLIRDTEQLTEKARMEYLSLFSHSHFFIPEIFKDLKKVIVLDDDVVIQRDLSFLWNLNMGDKVNGAVQFCGVRLGQVRNLLGK
  TKYDPKSCAWMSGVNVINLEKWRKHKVTENYLQLLKQVKRTDEASLRAAAFPLSLLSFRHLIYPLDVNLTLSGLGYDYGIEQEVAWSYASLHYNGNMKPW
  LE
Full Sequence
Protein Sequence     Length: 622     Download
MKATPPQRRR GPRVAVLALV LCSLLVPLAI LFDHASSSGD DVTTDERRRQ EVVLPSIDRV    60
VRRDPVIRLP VGGGVRQDAP KKISNGSSGV LPQPKQIDRR PSPSSTKPKV LPVPRTEPPK    120
AVMEPNRQEV ANDRKRRDRG AKADEVENAK ACQLEFGSYC LWSTEHKVMM KDSIVKKLKD    180
QLFVARSYYP SIAKLEGQEA LSQEMKQNIQ DHERILSASA VDADLPSFIN KRILEMEHTI    240
ARAKSCTVDC HNVDKKLLQI LDMTEDEAHF HMKQSAFLYN LGAQTLPKTH HCFSMRLTLE    300
YFKSSSLNSD VSSAHKFNTP NHKHYVILSK NVLAASVVIN STVINSKDPG NNVFHILTDA    360
QNFYGMKYWF ARNSYKKSAL HVINYEETIL EKLPKHSMRE MYLPEEFRVL IRDTEQLTEK    420
ARMEYLSLFS HSHFFIPEIF KDLKKVIVLD DDVVIQRDLS FLWNLNMGDK VNGAVQFCGV    480
RLGQVRNLLG KTKYDPKSCA WMSGVNVINL EKWRKHKVTE NYLQLLKQVK RTDEASLRAA    540
AFPLSLLSFR HLIYPLDVNL TLSGLGYDYG IEQEVAWSYA SLHYNGNMKP WLELGIPDYR    600
KYWRRYLTRE DQFMDECNVN P*                                             660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06429GT8_like_13.0e-76324608285+
PLN02718PLN027187.0e-78172619461+
PLN02910PLN029106.0e-89157620481+
PLN02829PLN028294.0e-97168621471+
PLN02769PLN0276901620629+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ26795.1016191629hypothetical protein OsJ_10706 [Oryza sativa Japonica Group]
GenBankEEC82698.10762115626hypothetical protein OsI_27362 [Oryza sativa Indica Group]
RefSeqNP_001050007.1016211631Os03g0330000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001060656.101462121625Os07g0681700 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002461225.1016211627hypothetical protein SORBIDRAFT_02g043170 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ss9_A0.0000642353076181A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB1ga8_A0.000142353076181A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB1g9r_A0.000142353076181A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan biosynthesis2.4.1.43-RXNEC-2.4.1.43polygalacturonate 4-α-galacturonosyltransferase
Transmembrane Domains
StartEnd
1332
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT9433792843246070
DR9630043082205270
CJ8012362493485960
GH7258392472915370
JG9379442593656220
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)