y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g18820.1
FamilyGT1
Protein PropertiesLength: 466 Molecular Weight: 50424.7 Isoelectric Point: 7.745
ChromosomeChromosome/Scaffold: 1 Start: 15075748 End: 15077145
DescriptionUDP-glucosyl transferase 73B5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1404443.20057e-42
  FAAPEPHLRQARARLHGWGHHHDLAAIRFRALAVPPHASPDPDPTSSSPFPAHMQPLFEAFCAGAGASLAALLAELAAAHRRVVVLHDRMAAFAAAEAVK
  LPNGEALGVHCLAASYNVGWADPGHALLREHGMAFHRPDACATPEFIALARRMGQERRRAPGAGMVVNSCRALEGEFLDVLLPLLPSSSDGRKLFAIGPL
  NPLLPPDTGKTTPEALERHECLRWLDEQPRASVLYISFGTTSSLRREQLAELAEALRKSGQRFLWSLRDADRADMRAPSPTSPGADMRVAAGEKGMVVTG
  WAPQLEILAHGATAAFMSHCGWNSTVESLSHGKPILAWPMHSDQPWDAELVCRYLGAGILVRPWERRGEVTPAAGVRDAIERAMRSEEGERVREAARKLG
  EAVRA
Full Sequence
Protein Sequence     Length: 466     Download
MATEPPPVAV VTVPFPAQGH LNQLLHLSLL LASRGIPVHF AAPEPHLRQA RARLHGWGHH    60
HDLAAIRFRA LAVPPHASPD PDPTSSSPFP AHMQPLFEAF CAGAGASLAA LLAELAAAHR    120
RVVVLHDRMA AFAAAEAVKL PNGEALGVHC LAASYNVGWA DPGHALLREH GMAFHRPDAC    180
ATPEFIALAR RMGQERRRAP GAGMVVNSCR ALEGEFLDVL LPLLPSSSDG RKLFAIGPLN    240
PLLPPDTGKT TPEALERHEC LRWLDEQPRA SVLYISFGTT SSLRREQLAE LAEALRKSGQ    300
RFLWSLRDAD RADMRAPSPT SPGADMRVAA GEKGMVVTGW APQLEILAHG ATAAFMSHCG    360
WNSTVESLSH GKPILAWPMH SDQPWDAELV CRYLGAGILV RPWERRGEVT PAAGVRDAIE    420
RAMRSEEGER VREAARKLGE AVRADVAHGR SSRRDLDDLV AYITR*                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02554PLN025543.0e-40177453289+
PLN02167PLN021671.0e-42198460275+
PLN03007PLN030072.0e-45203460265+
PLN02448PLN024483.0e-46234464235+
PLN00164PLN001643.0e-47196465278+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACD03254.10846511465UDP-glycosyltransferase UGT93B9 [Avena strigosa]
GenBankEEE67749.101246514462hypothetical protein OsJ_25448 [Oryza sativa Japonica Group]
RefSeqNP_001053526.1084659463Os04g0556500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001060532.101246514478Os07g0660500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002463331.1014641469hypothetical protein SORBIDRAFT_02g041935 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A3e-381046011474A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A3e-37196441202445A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A3e-37196441202445A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A3e-37196441202445A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B3e-351046412462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BQ8043762391854160
BQ9028172721994660
BQ9027682721994660
EG3969312602114660
HO1650712432314660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)