y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g19760.1
FamilyCE10
Protein PropertiesLength: 337 Molecular Weight: 35973 Isoelectric Point: 7.688
ChromosomeChromosome/Scaffold: 1 Start: 15815070 End: 15816080
Descriptioncarboxyesterase 18
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10403220
  SLGDHRSAANPSRPDASGVRSADVVVDAATGVWARVFSPSPPPPSAEDAPPLSVVVYFHGGGFALFSPASRPYDAFCRRLCRALGAAVVSVAYRLAPAHR
  FPAPYDDGLAVLRFLATSAAQIPVPLDLSRCFLAGDSAGGNIAHHVAHRWSSSSSSASSLNLAGVVLIQPFFGGEERTEAELELDKAIPSLSMAITDAYW
  RDFLPEGATRDHAAAACGVGELAEAFPPAMVAVGGFDLLKGWQARYVEKLRGMGKPVKVMEYPDAIHGFHVFPEIADSGKFLE
Full Sequence
Protein Sequence     Length: 337     Download
MAGPEEARRR PALPWTVRAQ LAALSLAHRR DGSVRRLLFS LGDHRSAANP SRPDASGVRS    60
ADVVVDAATG VWARVFSPSP PPPSAEDAPP LSVVVYFHGG GFALFSPASR PYDAFCRRLC    120
RALGAAVVSV AYRLAPAHRF PAPYDDGLAV LRFLATSAAQ IPVPLDLSRC FLAGDSAGGN    180
IAHHVAHRWS SSSSSASSLN LAGVVLIQPF FGGEERTEAE LELDKAIPSL SMAITDAYWR    240
DFLPEGATRD HAAAACGVGE LAEAFPPAMV AVGGFDLLKG WQARYVEKLR GMGKPVKVME    300
YPDAIHGFHV FPEIADSGKF LEDLKVFVQE HRAAKL*                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00312Esterase_lipase0.0029316270+
pfam00135COesterase0.00039313648+
PRK10162PRK101623.0e-1793308216+
COG0657Aes9.0e-3393312220+
pfam07859Abhydrolase_33.0e-6494309216+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ04888.101133520352hypothetical protein OsI_27070 [Oryza sativa Indica Group]
GenBankEAZ04907.1083365335hypothetical protein OsI_27088 [Oryza sativa Indica Group]
GenBankEAZ04908.101333617344hypothetical protein OsI_27089 [Oryza sativa Indica Group]
RefSeqNP_001060440.101333617344Os07g0643100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001060441.101133120348Os07g0643400 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A01132924349A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2zsh_A01132924349B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F023291348B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E023291348B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D023291348B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL7719532321143360
FL7719542021443360
CK206971278152790
EE172342247933310
FL930106245933300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00053.1Aquca_026_00256.1Aquca_026_00095.4Aquca_026_00095.1Aquca_026_00095.3
Aquca_026_00095.2Aquca_014_00051.1Aquca_009_00621.1Aquca_014_00054.1Aquca_001_00578.1
Aquca_001_00888.1Aquca_013_00490.1Aquca_013_00491.1Aquca_013_00492.1Aquca_026_00095.6
Aquca_026_00095.5Aquca_026_00095.7Aquca_001_00577.1
Arabidopsis lyrata496395488458351756904005486805
489214477795487467475988483697
Arabidopsis thalianaAT5G62180.1AT5G16080.1AT5G27320.1AT2G45600.1AT3G63010.1
AT5G23530.1AT3G05120.1AT5G06570.2AT5G06570.1AT1G68620.1
AT2G45610.1
Brachypodium distachyonBradi2g27300.1Bradi1g56860.1Bradi1g17780.1Bradi2g01817.1Bradi1g56830.1
Bradi1g19730.1Bradi1g06240.1Bradi1g19720.1Bradi1g67600.1Bradi1g19715.1.49.348
Bradi1g19715.1.49.348Bradi4g21690.1Bradi3g42207.1Bradi1g19750.1Bradi4g21700.1
Bradi1g21890.1Bradi2g25600.1Bradi1g19715.1.381.639Bradi1g19715.1.381.639Bradi1g56807.1
Bradi1g56870.1Bradi2g25470.1Bradi1g56910.1Bradi4g12370.1Bradi5g08900.1
Bradi3g21747.1Bradi1g56817.1Bradi1g67930.1
Brassica rapaBra035904Bra029278Bra040420Bra007722Bra008651
Bra009970Bra003520Bra004924Bra039460Bra009691
Bra026494Bra009207Bra004026Bra004327Bra004326
Bra038363Bra027693Bra004925Bra005899Bra029276
Carica papayaevm.model.supercontig_731.1evm.model.supercontig_142.11evm.model.supercontig_179.10evm.model.supercontig_142.10evm.model.supercontig_131.25
evm.model.supercontig_4.186evm.model.supercontig_18.158evm.model.supercontig_138.56evm.model.supercontig_3370.1evm.model.supercontig_18.159
evm.model.supercontig_259.4evm.model.supercontig_222.8evm.model.supercontig_84.118
Capsella rubellaCarubv10011599mCarubv10026772mCarubv10003763mCarubv10023611mCarubv10001368m
Carubv10017514mCarubv10025385mCarubv10014098mCarubv10001401mCarubv10020617m
Carubv10000013m
Citrus clementinaCiclev10005338mCiclev10026049mCiclev10012053mCiclev10020968mCiclev10028832m
Ciclev10001720mCiclev10024217mCiclev10005441mCiclev10020805mCiclev10005443m
Ciclev10031957mCiclev10020972mCiclev10024259mCiclev10007129mCiclev10001722m
Ciclev10020963mCiclev10007184mCiclev10005496mCiclev10021081mCiclev10024355m
Ciclev10002159mCiclev10012167mCiclev10005552mCiclev10023897mCiclev10012177m
Ciclev10003873mCiclev10001815mCiclev10020996mCiclev10012538mCiclev10007157m
Citrus sinensisorange1.1g019246morange1.1g020406morange1.1g019624morange1.1g019201morange1.1g019193m
orange1.1g038316morange1.1g039669morange1.1g019097morange1.1g019164morange1.1g019248m
orange1.1g019235morange1.1g038541morange1.1g024327morange1.1g024286morange1.1g020140m
orange1.1g042852morange1.1g041117morange1.1g040187morange1.1g020268morange1.1g019460m
orange1.1g040311morange1.1g026700morange1.1g038786morange1.1g029457morange1.1g039748m
orange1.1g036408morange1.1g036204morange1.1g042985m
Cucumis sativusCucsa.212660.1Cucsa.237740.1Cucsa.083880.1Cucsa.005130.1Cucsa.388430.1
Cucsa.153090.1Cucsa.055880.1Cucsa.088490.1Cucsa.163740.1Cucsa.237690.1
Cucsa.084780.1Cucsa.237670.1Cucsa.283760.1Cucsa.362930.1Cucsa.273140.1
Cucsa.237730.1
Eucalyptus grandisEucgr.A02852.1Eucgr.K03422.1Eucgr.A02850.1Eucgr.A02538.1Eucgr.A02854.1
Eucgr.B02030.2Eucgr.B02030.1Eucgr.A02853.1Eucgr.A02855.1Eucgr.J01495.1
Eucgr.B02030.3Eucgr.B03798.1Eucgr.J01051.1Eucgr.H01611.1Eucgr.I00033.1
Eucgr.J01049.1Eucgr.B03032.1Eucgr.J01050.1Eucgr.J01047.1Eucgr.C01748.1
Eucgr.A02537.1Eucgr.G03202.1Eucgr.H02260.1Eucgr.J01052.1Eucgr.D02432.1
Fragaria vescamrna10312.1-v1.0-hybridmrna21464.1-v1.0-hybridmrna21852.1-v1.0-hybridmrna31238.1-v1.0-hybridmrna22353.1-v1.0-hybrid
mrna18038.1-v1.0-hybridmrna03774.1-v1.0-hybridmrna13362.1-v1.0-hybridmrna21461.1-v1.0-hybridmrna13361.1-v1.0-hybrid
mrna19449.1-v1.0-hybridmrna20092.1-v1.0-hybridmrna27756.1-v1.0-hybridmrna14708.1-v1.0-hybridmrna11640.1-v1.0-hybrid
mrna19448.1-v1.0-hybridmrna21445.1-v1.0-hybridmrna14710.1-v1.0-hybridmrna21850.1-v1.0-hybrid
Glycine maxGlyma20g29190.1Glyma06g46520.1Glyma10g29910.1Glyma09g27516.1Glyma20g37430.3
Glyma20g37430.2Glyma02g17010.1Glyma16g33340.1Glyma08g47930.1Glyma19g39030.1
Glyma20g29200.1Glyma02g27091.1Glyma18g53580.1Glyma10g02790.1Glyma16g33330.1
Glyma03g36380.1Glyma03g30460.1Glyma06g46680.1Glyma09g28580.1Glyma10g11060.1
Glyma16g33320.1Glyma17g31740.1Glyma09g28590.1Glyma12g10250.2Glyma10g42260.1
Glyma20g24780.1Glyma07g09030.1Glyma03g02330.1Glyma06g46520.2Glyma16g32560.1
Glyma07g09040.1Glyma16g32571.1Glyma03g36380.2Glyma04g15930.2Glyma13g25900.2
Glyma09g28610.2
Gossypium raimondiiGorai.008G054000.1Gorai.013G203500.1Gorai.013G203500.2Gorai.006G117200.2Gorai.004G265600.1
Gorai.006G117200.1Gorai.008G007200.1Gorai.007G301300.1Gorai.004G244100.1Gorai.N020400.2
Gorai.N020400.1Gorai.N020400.4Gorai.N020400.3Gorai.007G180400.1Gorai.004G265700.1
Gorai.010G114500.1Gorai.010G215600.1Gorai.001G173200.1Gorai.004G214300.1Gorai.007G132800.2
Gorai.007G132800.1Gorai.011G116900.1Gorai.008G282100.1Gorai.012G038300.1Gorai.008G184600.1
Gorai.003G140500.2Gorai.003G140500.1Gorai.006G146700.1Gorai.007G301300.2Gorai.007G093200.1
Linum usitatissimumLus10013774Lus10002254Lus10000928Lus10017587Lus10024087
Lus10013377Lus10002019Lus10033548Lus10039162Lus10041632
Lus10009308Lus10008439Lus10002907Lus10015988Lus10027969
Lus10015989Lus10036168Lus10029541Lus10041473Lus10016204
Lus10029341Lus10013376Lus10018963
Malus domesticaMDP0000266393MDP0000549369MDP0000702676MDP0000302390MDP0000209102
MDP0000445131MDP0000868088MDP0000193399MDP0000933387MDP0000823593
MDP0000834172MDP0000153512MDP0000638650MDP0000729982MDP0000293827
MDP0000319301MDP0000929994MDP0000212363MDP0000319522MDP0000394001
MDP0000772938MDP0000376469MDP0000811098MDP0000767905MDP0000830926
MDP0000188790MDP0000769340MDP0000682570MDP0000131356MDP0000121191
MDP0000312660MDP0000501425MDP0000206715MDP0000173942
Manihot esculentacassava4.1_021781mcassava4.1_022890mcassava4.1_027884mcassava4.1_011475mcassava4.1_024162m
cassava4.1_023579mcassava4.1_011926mcassava4.1_021060mcassava4.1_011042mcassava4.1_011040m
cassava4.1_011041mcassava4.1_011074mcassava4.1_011423mcassava4.1_011066mcassava4.1_030617m
cassava4.1_010495mcassava4.1_011600mcassava4.1_011817mcassava4.1_032011mcassava4.1_028611m
cassava4.1_024667mcassava4.1_011349mcassava4.1_011547mcassava4.1_020892mcassava4.1_021805m
cassava4.1_029404mcassava4.1_027577m
Medicago truncatulaMedtr1g102170.1Medtr1g082210.1Medtr1g089310.1Medtr6g065430.1Medtr6g065120.1
Medtr7g093950.1Medtr6g065270.1Medtr8g035540.1Medtr6g065400.1Medtr1g102160.1
Medtr8g035520.1Medtr6g065370.1Medtr6g065110.1Medtr6g065340.1AC233660_26.1
Medtr8g035500.1Medtr1g012430.1
Mimulus guttatusmgv1a010087mmgv1a009262mmgv1a009369mmgv1a018241mmgv1a009399m
mgv1a009336mmgv1a008950mmgv1a018055mmgv1a023984mmgv1a008534m
mgv1a008668mmgv1a018147mmgv1a008861mmgv1a008737mmgv1a010399m
mgv1a008690mmgv1a009655mmgv1a023895mmgv1a010082mmgv1a010080m
mgv1a019510mmgv11b023492mmgv11b021044m
Oryza sativaLOC_Os01g06220.1LOC_Os07g44890.1LOC_Os01g06060.1LOC_Os01g06210.1LOC_Os03g57640.1
LOC_Os07g44860.1LOC_Os07g06850.1LOC_Os07g06880.1LOC_Os07g06860.1LOC_Os08g43430.1
LOC_Os11g13570.1LOC_Os06g20200.1LOC_Os11g13670.1LOC_Os07g06840.1LOC_Os07g44900.1
LOC_Os07g44910.2LOC_Os07g44910.1LOC_Os07g44850.1LOC_Os07g41590.1LOC_Os11g13630.1
LOC_Os05g33730.1LOC_Os03g15270.1LOC_Os07g06830.1LOC_Os03g14730.1LOC_Os05g33940.1
LOC_Os12g04150.1LOC_Os11g04350.1LOC_Os12g04140.1LOC_Os11g04360.1
Panicum virgatumPavirv00008025mPavirv00015838mPavirv00058244mPavirv00014880mPavirv00041749m
Pavirv00056548mPavirv00023156mPavirv00070174mPavirv00048179mPavirv00052142m
Pavirv00001191mPavirv00030872mPavirv00006154mPavirv00058907mPavirv00041750m
Pavirv00026130mPavirv00008276mPavirv00055122mPavirv00021506mPavirv00024792m
Pavirv00028910mPavirv00055985mPavirv00055986mPavirv00063807mPavirv00057275m
Pavirv00025759mPavirv00058002mPavirv00018247mPavirv00033006mPavirv00028147m
Pavirv00002247mPavirv00024029mPavirv00036540mPavirv00025899mPavirv00058927m
Pavirv00012215mPavirv00069461mPavirv00022808mPavirv00042463mPavirv00061274m
Pavirv00034983mPavirv00066260mPavirv00048346mPavirv00033502mPavirv00068878m
Pavirv00016447mPavirv00068880mPavirv00034848mPavirv00011581mPavirv00033501m
Pavirv00019866mPavirv00027406mPavirv00032027mPavirv00022807mPavirv00028051m
Pavirv00017465mPavirv00042989mPavirv00042520mPavirv00034561m
Physcomitrella patensPp1s297_21V6.4Pp1s297_21V6.3Pp1s297_21V6.2Pp1s297_21V6.1Pp1s25_331V6.1
Pp1s37_32V6.4Pp1s37_32V6.3Pp1s37_32V6.2Pp1s37_32V6.1Pp1s91_36V6.1
Pp1s33_210V6.1
Phaseolus vulgarisPhvul.011G100900.1Phvul.004G123800.1Phvul.011G100800.1Phvul.007G064600.1Phvul.007G183400.1
Phvul.007G167600.1Phvul.007G064700.1Phvul.004G132800.1Phvul.004G133000.1Phvul.005G016400.1
Phvul.001G146300.1Phvul.001G198900.1Phvul.004G073600.1Phvul.004G133100.1Phvul.004G074300.1
Phvul.007G264900.1Phvul.010G086500.1Phvul.004G123900.1Phvul.008G004600.1Phvul.011G197000.1
Phvul.007G025700.1Phvul.010G086400.1Phvul.001G051600.1Phvul.004G123700.1Phvul.004G074400.1
Picea abiesMA_9721034g0010MA_10296151g0010MA_9392760g0010MA_10435233g0020MA_46821g0010
MA_42231g0010MA_304461g0010MA_5588g0010MA_101170g0020MA_3180g0010
MA_129063g0010MA_10207543g0010MA_170302g0010MA_16525g0010MA_28455g0010
MA_8180539g0010MA_93044g0010MA_269822g0010MA_423315g0010MA_10437184g0010.195.444
MA_10437184g0010.195.444MA_55939g0010MA_10429622g0010.151.347MA_10429622g0010.151.347MA_131537g0010
MA_6062370g0010MA_10432405g0010MA_10382897g0010MA_7579711g0010MA_27832g0010
MA_10426025g0010MA_10426093g0030MA_9955818g0010MA_10428213g0010MA_23660g0010
MA_17969g0010MA_8981253g0010MA_81388g0010MA_10428792g0010MA_10437184g0010.59.189
MA_10437184g0010.59.189MA_10429622g0010.18.122MA_10429622g0010.18.122MA_96486g0010MA_4826396g0010
Populus trichocarpaPotri.001G032400.1Potri.003G192600.1Potri.017G113700.1Potri.015G137100.1Potri.T024600.1
Potri.019G014400.1Potri.005G040600.1Potri.004G101400.1Potri.009G155800.1Potri.013G028700.1
Potri.014G135900.3Potri.014G135900.2Potri.014G135900.1Potri.002G213100.1Potri.006G198800.1
Potri.014G073000.1Potri.001G459400.1Potri.004G092500.1Potri.016G065000.1Potri.001G466200.1
Potri.001G466400.1Potri.010G127600.1Potri.001G466300.1Potri.T024800.1Potri.018G028300.1
Potri.008G118400.1Potri.016G031500.1Potri.002G150900.1Potri.006G253300.1Potri.016G065000.2
Potri.018G028400.1Potri.014G073100.1Potri.004G075000.1
Prunus persicappa008273mppa018617mppa016280mppa023695mppa008373m
ppa008440mppa026008mppa018174mppa008578mppa023957m
ppa019404mppa008128mppa008109mppa008412mppa009018m
ppa026623mppa016730mppa023588mppa021562m
Ricinus communis30147.m01414130205.m00158529686.m00086129910.m00096629910.m000927
30128.m00869530008.m00079629703.m00150629333.m00109830147.m014142
28883.m00073629755.m00044029983.m00330430174.m00892130174.m008923
30174.m00892229848.m004636
Setaria italicaSi030325mSi030352mSi026570mSi030400mSi002225m
Si032545mSi036588mSi036247mSi030423mSi030411m
Si030476mSi030409mSi039159mSi030397mSi022545m
Si026572mSi029953mSi032705mSi030425mSi022513m
Si022510mSi014005mSi014968mSi030493mSi024051m
Si032595mSi025071mSi027458mSi026510mSi036079m
Si003165m
Selaginella moellendorffii1012418983489683166817169817
1698131473012632825100138855
97885146043511427114314639
1038212453934699440349
Sorghum bicolorSb05g007290.1Sb02g003610.1Sb02g003620.1Sb01g005720.1Sb03g005590.1
Sb02g003580.1Sb02g003600.1Sb02g020810.1Sb02g003570.1Sb02g041040.1
Sb05g007270.1Sb07g025010.1Sb03g005570.1Sb02g041050.1Sb02g038880.1
Sb09g020080.1Sb09g020080.2Sb02g041000.1Sb02g003630.1Sb01g040580.1
Sb02g003560.1Sb03g005580.1Sb03g005560.1Sb09g020220.1Sb09g020230.1
Sb05g008440.1Sb01g040930.1Sb02g041020.1Sb05g008610.1
Thellungiella halophilaThhalv10005595mThhalv10013981mThhalv10004511mThhalv10006072mThhalv10004556m
Thhalv10021054mThhalv10014072mThhalv10019529mThhalv10001767mThhalv10001557m
Vitis viniferaGSVIVT01010672001GSVIVT01037525001GSVIVT01022014001GSVIVT01018455001GSVIVT01025780001
GSVIVT01022491001GSVIVT01035846001.199.457GSVIVT01035846001.199.457GSVIVT01035846001.199.457GSVIVT01035846001.199.457
GSVIVT01035848001GSVIVT01022508001GSVIVT01035846001.602.875GSVIVT01035846001.602.875GSVIVT01035846001.602.875
GSVIVT01035846001.602.875GSVIVT01035849001GSVIVT01031065001GSVIVT01036591001GSVIVT01011037001
GSVIVT01011925001GSVIVT01022510001GSVIVT01025797001GSVIVT01037191001GSVIVT01037190001
GSVIVT01000258001GSVIVT01027566001GSVIVT01027568001
Zea maysAC211504.4_FGT003AC209636.2_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)